KEGG   Mus musculus (mouse): 232493
Entry
232493            CDS       T01002                                 

Symbol
Gys2, BC021322, L, LGS
Name
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00500  Starch and sucrose metabolism
mmu01100  Metabolic pathways
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04910  Insulin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    232493 (Gys2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    232493 (Gys2)
   04152 AMPK signaling pathway
    232493 (Gys2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    232493 (Gys2)
   04922 Glucagon signaling pathway
    232493 (Gys2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    232493 (Gys2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    232493 (Gys2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    232493 (Gys2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     232493 (Gys2)
Glycosyltransferases [BR:mmu01003]
 Polysaccharide
  Storage polysaccharide
   232493 (Gys2)
SSDB
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Other DBs
NCBI-GeneID: 232493
NCBI-ProteinID: NP_663547
MGI: 2385254
Ensembl: ENSMUSG00000030244
Vega: OTTMUSG00000023569
UniProt: Q8VCB3
Position
6; 6 G2
AA seq 704 aa
MLRGRSLSVTSLGGLPVWEAERLPVEDLLLFEVSWEVTNKVGGICTVIQTKAKTTADEWG
ENYFLIGPYFEHNMKTQVEQCEPTNDAVRKAVDAMNKHGCQVHFGRWLIEGSPYVVLFDI
SSSAWNLDRWKGDFWEACGVGIPHHDREANDMLIFGSLTAWFLKEVTDHADGKHVIAQFH
EWQAGTGLILSRARKLPIATVFTTHATLLGRYLCAANIDFYNQLDKFDIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSNV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTVHCLKEKFGKKLYDGLLRGEIPDMNSIL
DRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRADRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFVQE
HVADPTAYGIYIVDRRFRSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARHLTLSRAFPDKFHLEPTSPPTTDGFKYPRPSSVPPSPSGSQASSPQCSDAE
DEEDEDERYDEEEEAERDRLNIKSPFSLNHFPKGKKKLHGEYKN
NT seq 2115 nt   +upstreamnt  +downstreamnt
atgctcagaggccgctccttgtcggtgacatcccttggtgggctccctgtgtgggaagct
gaaagactccctgtggaagacttactgctttttgaagtttcttgggaggtgaccaacaaa
gttgggggcatctgtactgtgatccagaccaaggccaaaacgacagccgatgagtgggga
gagaattacttcctgataggtccgtactttgagcataatatgaagactcaagtagaacaa
tgtgagcccaccaacgatgctgtcagaaaagctgtggatgcgatgaataaacatggctgc
caggtgcattttggaagatggctcatagaagggagtccctacgtggtgctctttgacatc
agctcctcagcatggaacctggacagatggaagggtgacttctgggaagcttgtggcgtt
ggcatccctcatcatgaccgagaagctaacgacatgctcatatttgggtctttaactgcc
tggttcttaaaggaggtgacagaccacgcagacggtaaacacgtcattgcccaattccat
gaatggcaggctgggactgggctgatcctttctcgtgccaggaaactccccattgccaca
gtatttacaacccatgccacactgcttgggcgttatctctgtgcagcaaatattgacttc
tacaaccagcttgacaagttcgacattgacaaagaggccggggagaggcagatataccac
cgctactgcatggagcgggcatccgtgcactgtgcgcacgtgttcaccacagtgtcagaa
atcacagccatcgaggcagagcacatgctgaagaggaagcctgatgtagtgactccaaat
ggtttgaatgttaagaagttttctgcagtgcatgaatttcaaaatctccacgccatgtac
aaggccaggatacaggatttcgttcgaggtcatttctatggtcatctggactttgatctt
gagaagactttattcctcttcattgctgggagatatgaattctcaaacaaaggagcagac
atcttcctggagtccttatccaggcttaatttcctcctgaggatgcataagagtaacgtc
accgtggtagtgtttttcatcatgcctgccaagacaaacaatttcaacgtggaaaccctg
aagggccaggcagtgcggaaacagctgtgggacactgtgcattgtttgaaggagaagttt
gggaagaaactctatgacgggttattaagaggagaaattcctgacatgaatagtattttg
gatcgagatgacttaacaattatgaaaagggccattttttcaactcagagacagtctttg
cctcctgtgaccactcacaatatgatcgatgattccacggatcccatcctcagcaccatt
agacgaatcggacttttcaacaatcgtgcagacagagtcaaggtgattttacacccagaa
ttcctgtcctccaccagccctctattgcccatggattatgaagagtttgtccgaggttgt
caccttggggtgtttccatcgtactatgaaccctggggttacacaccagctgaatgcaca
gtgatgggcatccccagtgtgactacaaacctctccggttttgggtgtttcgtgcaggag
catgtggctgaccctactgcatacggtatttacatcgtggacagacgcttccgctctcca
gacgattcttgcaaccagctgactcagttcctctacgggttttgtaaacagtcacgccgg
caaaggatcattcagaggaaccgcacggagaggctctcagatctcctggactggagatac
ctgggcagatattaccagcatgccagacacctgacactgagcagggcttttccagacaaa
ttccacctagagcccacatcaccaccaacgacggatggctttaagtatcccaggccctcc
tcagtaccaccttctccgtcaggatcccaggcctccagtcctcagtgcagtgatgcggaa
gacgaagaagatgaggatgagaggtatgatgaggaagaggaggctgagagggatcggcta
aatatcaagtcaccgttttctctgaaccactttccaaaggggaagaaaaagcttcatgga
gaatataagaactga

DBGET integrated database retrieval system