KEGG   Mus musculus (mouse): 232536Help
Entry
232536            CDS       T01002                                 

Gene name
Mrps35, MDSO23, MRP-S28, MRPS28
Definition
(RefSeq) mitochondrial ribosomal protein S35
  KO
K17413  small subunit ribosomal protein S35
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmu03011]
    232536 (Mrps35)
Ribosome [BR:mmu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    232536 (Mrps35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP-S28 IFR3_antag
Motif
Other DBs
NCBI-GeneID: 232536
NCBI-ProteinID: NP_663548
MGI: 2385255
Ensembl: ENSMUSG00000040112
Vega: OTTMUSG00000023793
UniProt: Q8BJZ4 A0A0R4J0L6
Position
6; 6 G3
AA seq 320 aa AA seqDB search
MAAAALQLRQTLCPGARVLRTFSSVASPAAPRAGPRTASRSERPMRRKALPPRTEKMDTD
QDWPSVYPTAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKRHC
AALKDFCTEWPAALDSDEKCEEHFPVEIDTADYVSSGPSIRNPKARAVTLRVKLSSLNLD
NHAKKKLIKLVGERYCKATDVLTITTDRCPLKRQNCDYAVYLLTVLYHESWKTEDWENSK
TEEDMDEYVWAKSSSENSVLQTLLQMRAAESSVAPSREELLGTKEVEDYQKCIVRLKNEG
ENEASLAQYKESVKRLLNLA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgccgcgctgcagctgaggcagaccctgtgcccgggagcgcgcgtcctgcgc
accttctcctcggtcgccagccccgcggctccgagagccggcccgcgtacggcatccaga
agcgaaaggccgatgaggagaaaggcactacctcctaggacggagaagatggatactgat
caggactggcccagtgtttaccccactgccgcgccgtttaaaccctcagctgttcctcta
cctgttcgaatgggatacccagtaaagaagggtgtgcccatggcgaaggaagggaatcta
gagcttttaaagatcccaaattttctgcatttgactcctgtggcaattaaaaggcactgt
gcagcattgaaagatttctgcactgagtggccagctgcactcgacagtgatgagaaatgt
gaggagcattttccagttgagattgatacagcggattatgtgtcatcgggaccatctatt
cgaaaccccaaagcccgagccgtaacgttaagggttaaactttccagtttgaatttagac
aatcatgccaagaaaaaactcattaagcttgtaggagagcggtactgcaaggccaccgat
gtgctcactatcaccacagacagatgccctttgaagcggcagaactgtgactatgcagtg
tatcttctcacagtcctgtaccacgaatcttggaaaactgaagactgggaaaacagtaag
accgaggaagacatggacgagtatgtgtgggcaaagagctcctcggagaacagtgtcctt
cagaccctgctgcagatgagagctgcggagagcagtgtggcgccgagcagagaagagctg
ctggggaccaaagaggtcgaggattatcagaagtgtatcgttcgtctcaagaacgagggg
gagaacgaggcaagcctcgctcagtacaaggagtctgtgaagagactgttaaatttggcg
tga

DBGET integrated database retrieval system