KEGG   Mus musculus (mouse): 232566
Entry
232566            CDS       T01002                                 

Gene name
Amn1, 5830467E07Rik, A230083D09, C730024G19Rik
Definition
(RefSeq) antagonist of mitotic exit network 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: LRR_6 LRR_4
Other DBs
NCBI-GeneID: 232566
NCBI-ProteinID: NP_001106895
MGI: 2442933
Ensembl: ENSMUSG00000068250
Vega: OTTMUSG00000024377
UniProt: B8JKV0
Position
6; 6 G3
AA seq 258 aa
MPLSGVVSQLLELCLQYLVINISRYISDIKYLPSNIKDRLIKIMSIRGRITDSNISEVLH
PEVQRLDLRSCDISDVALQHLCKCRKLKALNLKSCREHRNSITSEGIKAVASSCSDLHEI
YLKGCCSVTDEGVLALALNCHLLKIIDLGGCLGITDVSLHALGKNCPFLQCVDISTTQVS
DNGVVALVSGPCAKQLEEINMRYCINLTDKAVEAALTACPRICILLFHGCPLITDRSQEV
LEQLIGSRKLKQVTWSVY
NT seq 777 nt   +upstreamnt  +downstreamnt
atgcctttgtccggagtagtcagtcagctcctggaactatgtcttcagtacctagtaatc
aatatttccagatatatatcagatattaaatatttgccttccaacattaaagatagacta
attaaaataatgagcattcggggtcggataacagattccaatataagtgaggtgttacat
cctgaagttcaaagactagatctgaggagctgtgatatctcagatgtggctctccagcac
ctgtgtaagtgcagaaaactgaaggcactaaatctaaaatcctgcagagaacatagaaat
agcataacttcagaaggaataaaagctgtggcttcatcctgttcagaccttcatgaaatt
tatttgaaaggatgttgcagtgtcactgatgaaggagtccttgctcttgcactcaattgt
catctgctaaagatcattgatttgggtggctgcttaggtattactgatgtgtccttacat
gcattaggaaaaaactgcccatttctgcagtgtgttgacatttcaactacgcaggtatct
gacaatggtgtggttgcacttgttagtggaccatgtgccaaacaattagaggagattaac
atgagatactgtataaatctaactgataaggctgtagaagctgctctgactgcatgtcct
cggatatgtatacttcttttccatggctgccccctgataacagatcgttcacaagaagtc
ttggagcaattaataggatcaagaaaactaaagcaagtgacttggtctgtttattga

DBGET integrated database retrieval system