KEGG   Mus musculus (mouse): 232664
Entry
232664            CDS       T01002                                 

Gene name
Ccdc136, 4921511K06Rik, BC006583
Definition
(RefSeq) coiled-coil domain containing 136
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: GAS FlxA Baculo_PEP_C
Other DBs
NCBI-GeneID: 232664
NCBI-ProteinID: NP_663549
MGI: 1918128
Ensembl: ENSMUSG00000029769
Vega: OTTMUSG00000023565
UniProt: Q3TVA9 E6Y2W6
Position
6; 6 A3.3
AA seq 1002 aa
MGKHRGLSLTETELEELRAQVLQLVAELEETRELAGQHEDDSLELQGLLEDERLASAQQA
EVFTKQIQQLQGELQHLREEISLLEHEKESELKEMEQELHLAQAEIQNLRQAAADSATEH
ESDIASLQDDLCRLQNDLDDMERIRGDYEMEIASLRAEMELKTSEPSNLSISDFSGIQDE
LHHLRERYNLLNEEYQALRESNSSLTGQLAELESDRTRRATERWLESHLLRSTMSSESQT
SELDFPEPDPVMQLLRQQLLGAEEQMQDMQDKCKNLYCELEELQHHRRTSEEEQKRLQRE
LKCAQNEVLRFQTSHSTQHEELKSRLCTLQQKYDASQDEHSELLKVQMQLETELQQLRLL
RCTPVESQSEKELMCRLQKLQAQHQCSVNEKEQLLEVQHHLHDKLRCHESEVHRLRSMVD
CLREKNEKNSGIHLQLQEMKGLYQFSRDELERQKHMYDQLEQDFLLCQQELTELKSSQSL
CEENGNCSNKCDALLARLTELQDKFKASQEEIGHLQMEQCELLEDQRRLQEEQGQLQEEL
HRLTFPQPKCGILQKSQELLSKLQDLCEMQLLYQNMQEQQRKLTQNQECVLKEQLEAHKH
LRGFKESHFQEVLANPQDARGPKSSSCENKFKVLMDQLQALQVLYDTSQKQQEVLQREHG
RLMEERKRLQAELQLCMEEMQVLQTQSPMIKRSFEYCGKNSGSRAPSTENFHRSYESSID
ENEGYQKSYVSSQPSTETFLKSYDSSTSANEAFEKSYCSSSTSVSYKKSYGSVSSGETLH
RSYASSSTDEDPAEPEDLEHFEETVAKVLTKLQAVKALYQVSQEEHCQLQQRMHRLLAKQ
KELTEELQCCEKELRECMESLGKPLPPQSDKCEIKELQTKLRELQLQYQASMDEQGRLLA
VQEQLEGQLQCCQEELRQLKENRPSISSEARGKNVNKNMNKNANGVRNKKLSMACSEDLE
NGFENEKNMFGMWKPMVFLAIAAVALYVLPNMRPQESEYYMK
NT seq 3009 nt   +upstreamnt  +downstreamnt
atgggcaagcatcggggcctgagcctgacagagacagagctggaggagctgagggcccag
gtgctgcagctggtggcagagctggaggagacccgtgagcttgctgggcagcatgaagat
gactccctggagcttcaggggctcctggaggatgagcggctggccagtgcccagcaagca
gaagtattcaccaagcagattcagcagctccaaggtgagctgcaacatctacgggaggag
atttccctgttagagcatgagaaggaaagcgaacttaaagaaatggagcaggagttgcat
ttggcccaagcagagatccaaaatctacggcaagctgcggcagactctgccactgaacat
gagagtgacatagcgtccttgcaggatgatctctgccggttgcagaatgatctcgatgac
atggagcgcattcgaggggactatgagatggagattgcctcgctccgggcagaaatggaa
ttgaagacttctgaaccatctaatctaagcatctccgacttctctgggatacaagatgaa
ctacaccatcttcgggagcgctacaacttactgaatgaggagtatcaggccttgcgggag
agcaacagcagcctcacagggcagcttgctgagctggagagtgataggacacggagagca
acagagcgatggttggaatctcacctgctacggagtacgatgtcctccgagtctcagacg
tcagaactggatttcccagagcctgaccctgtgatgcagcttttgcgccagcagctgctg
ggagctgaggaacagatgcaggacatgcaggacaagtgtaagaacttgtattgtgaattg
gaagagctacagcatcaccgcagaaccagtgaggaggagcagaagcggctgcagagggag
ctcaagtgtgcccagaatgaggtgctccggtttcagacctcccacagcacccagcatgag
gagctgaagagcaggctctgtaccctgcagcagaagtatgacgctagccaggacgagcac
agtgagcttctgaaggtgcagatgcagctcgagactgagctccagcagctcagactcctc
agatgcactcctgtagagagccagagtgagaaggagttgatgtgccggctccagaagctg
caggcccagcaccagtgcagtgtgaatgagaaagagcagcttctagaagtccagcatcac
ctgcacgacaagctgcggtgccacgagtcagaggtgcatcggctccgaagcatggtggac
tgcttgcgagagaaaaatgagaagaattcagggatacacctccagcttcaggagatgaag
ggattgtatcagttcagcagggatgagctggagcgccagaagcacatgtatgaccagctg
gagcaggacttcctgctctgccagcaggagctgacagagctcaagtccagccagtccctc
tgtgaagagaatggaaactgctcaaacaagtgtgatgctctgctggccagactgacagaa
ttgcaggacaagttcaaagccagccaggaggagattgggcacctgcagatggaacagtgt
gagctcctggaggaccagaggaggctgcaggaggagcagggccagctgcaggaagagctg
cacaggctcacattcccacagcccaaatgtggcatcttgcagaagagtcaggagctgctt
tcaaagctgcaagatctgtgtgaaatgcagctgctctaccaaaacatgcaggagcaacag
cgaaagctgacacaaaaccaggagtgtgtactgaaggagcagctagaggcacacaagcat
cttcgaggtttcaaagagtctcatttccaggaagtgttggcgaaccctcaagatgctaga
gggcctaagtcctccagttgtgagaataagttcaaggtgcttatggaccagctgcaggct
ctgcaggtgctatatgacaccagtcagaaacagcaggaggtactgcagcgggagcatggg
cggctcatggaggagcggaagaggctgcaggctgagctacagctctgcatggaagaaatg
caggtgctccaaactcagtcccccatgataaaaaggagttttgagtactgcgggaagaac
tcaggcagcagggcccccagcactgagaacttccacaggagttacgagagctccattgat
gaaaatgagggctatcagaagagttatgtgagctcccagcccagcactgaaaccttcctc
aagagctatgacagtagcaccagtgccaacgaggcctttgagaagagttactgctccagc
agcacaagtgtgagctataagaagagttatggctctgtcagtagtggtgagacccttcac
aggagctatgccagcagcagtactgatgaggacccagctgagcctgaagacttggagcac
tttgaggaaacagtggccaaggtgctgaccaagttgcaggcagtgaaggccctgtaccaa
gtgagccaggaagagcactgccagctgcagcaacggatgcacaggctgctggccaagcag
aaggagctcacagaggagctgcagtgctgcgagaaggagctgagggagtgcatggagagc
ctggggaagcccctgcctccccagagtgacaagtgcgagatcaaagaactgcaaactaag
ctgcgggagctgcagctgcagtaccaggctagcatggatgagcaggggcggcttctggcc
gtgcaggagcagctggaggggcagctgcagtgctgccaggaagaactccgccagctcaaa
gaaaacaggccctctattagctcagaagccaggggcaagaatgtcaataagaatatgaac
aagaatgccaatggagttagaaataagaagctgagcatggcgtgctcagaggatttggag
aacggttttgagaatgaaaagaacatgtttgggatgtggaagcctatggttttcttggct
attgcagcagtagctctgtatgtgttacccaatatgcgaccgcaggaatcagaatactac
atgaagtga

DBGET integrated database retrieval system