KEGG   Mus musculus (house mouse): 232791
Entry
232791            CDS       T01002                                 
Symbol
Cnot3, A930039N10Rik
Name
(RefSeq) CCR4-NOT transcription complex, subunit 3
  KO
K12580  CCR4-NOT transcription complex subunit 3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    232791 (Cnot3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    232791 (Cnot3)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     232791 (Cnot3)
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     232791 (Cnot3)
SSDB
Motif
Pfam: Not3 NOT2_3_5
Other DBs
NCBI-GeneID: 232791
NCBI-ProteinID: NP_666288
MGI: 2385261
Ensembl: ENSMUSG00000035632
UniProt: Q8K0V4
Position
7:3646717..3664108
AA seq 751 aa
MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRD
QIKTWVASNEIKDKRQLIENRKLIETQMERFKVVERETKTKAYSKEGLGLAQKVDPAQKE
KEEVGQWLTNTIDTLNMQVDQFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHV
RMLETILRMLDNDSILVDAIRKIKDDVEYYVDSSQDPDFEENEFLYDDLDLEDIPQALVA
TSPPSHSHMEDEIFNQSSSTPTSTTSSSPIPPSPANCTTENSEDDKKRGRSTDSEVSQSP
AKNGSKPVHSNQHPQSPAVPPTYPSGPPPTTSALSSTPGNNGASTPAAPTSALGPKASPA
PSHNSGTPAPYAQAVAPPNASGPSNAQPRPPSAQPSGGSGGGSGGSSSNSNSGTGGGAGK
QNGATSYSSVVADSPAEVTLSSSGGSSASSQALGPTSGPHNPAPSTSKESSTAAPSGAGN
VASGSGNNSGGPSLLVPLPVNPPSSPTPSFSEAKAAGTLLNGPPQFSTTPEIKAPEPLSS
LKSMAERAAISSGIEDPVPTLHLTDRDIILSSTSAPPTSSQPPLQLSEVNIPLSLGVCPL
GPVSLTKEQLYQQAMEEAAWHHMPHPSDSERIRQYLPRNPCPTPPYHHQMPPPHSDTVEF
YQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQG
TYIYFDYEKWGQRKKEGFTFEYRYLEDRDLQ
NT seq 2256 nt   +upstreamnt  +downstreamnt
atggcggacaagcgcaaactccaaggtgagattgatcgctgcctcaagaaggtgtccgaa
ggggtggagcagtttgaagatatttggcaaaagctccacaatgcagccaacgcgaaccag
aaagaaaagtatgaggctgacctaaagaaggagattaagaagctacaacggctgagggac
cagatcaagacatgggtagcatcaaatgagatcaaggacaaaaggcagcttattgaaaac
cgcaagctcattgagacgcaaatggaacggttcaaagttgtggaacgagagaccaaaacc
aaagcgtatagcaaggagggtctgggtctggctcagaaggtggatcctgcccagaaggag
aaggaagaagttggccagtggctcacgaacaccattgacaccttaaatatgcaggtggac
cagtttgagagtgaagtggagtcactgtcggtacagacacgcaagaagaaaggcgacaag
gataagcaggaccggattgagggcttgaagcggcatatcgagaagcaccgctaccatgtt
cgtatgctggagaccatcctgcgaatgctggacaatgactccatcctggttgatgccatc
cgcaagatcaaggatgatgtggagtactacgttgactcatcccaggaccccgactttgaa
gagaacgaattcctctatgacgacctggacctcgaggacattccacaggcgctggtcgcc
acctccccccccagccacagccacatggaggacgagatcttcaaccagtctagcagtaca
cccacctcaacaacctccagctctcccatcccacccagcccagcaaactgcactacggaa
aactctgaagatgataagaagagaggccgatctacagatagtgaagtcagccagtctcca
gccaaaaatggctccaagcctgtccacagcaaccagcacccccagtccccagctgtgccg
cccacctacccctctggccccccacctaccacttctgccttgagctccacccctggcaac
aatggggcctctaccccagcagcacctacaagtgccctgggccctaaggccagtccagct
cccagccacaactcgggtactcctgcaccctatgcccaggctgtggccccacctaatgcc
agcgggcccagcaatgcccagccacggccccccagtgcccagccaagcgggggaagtggt
ggtggcagcggagggagcagcagcaatagtaacagtggcacaggcggaggggctggcaag
cagaacggtgccacaagctatagttcggttgtggcagacagccctgcagaggtgaccctg
agtagcagtgggggcagcagtgccagcagccaagcccttgggcccacttcgggccctcac
aacccagctcccagcacctcaaaggaatccagtacggcagccccatcaggggctgggaat
gtggcttcaggctcagggaataactcggggggacccagcctcttggtgccactgcctgta
aatccccccagttctccaacgcccagcttcagtgaagccaaggcagctggtaccctgctt
aatggtcctccacagttcagcaccaccccagaaatcaaggcccctgaaccactcagctct
ctgaaatccatggcagaacgggcagctatcagctctggtattgaggaccctgtgccaacg
ttacacctaactgatcgagacatcatcctgagcagcacatcagcaccacccacctcatcc
cagccacccctgcagctgtcagaggtgaacataccattgtcactgggtgtctgtccactg
gggccagtttccctcaccaaggagcagctataccaacaggccatggaagaggccgcctgg
caccacatgccccacccctctgactccgagcgcattcggcagtacctcccccggaaccct
tgcccgacacccccctaccaccaccagatgccacccccacactcggacactgtggagttc
taccagcgcctgtcaactgagacgctcttcttcatcttctactatctggagggaaccaag
gcacagtacttggcagccaaggccctaaagaagcagtcctggcgattccacaccaagtat
atgatgtggttccagaggcacgaggagcctaagaccatcacagatgagtttgagcagggc
acctacatctactttgactacgagaagtggggccagcggaagaaggaaggcttcaccttt
gagtaccgctacctggaggaccgggacctccagtga

DBGET integrated database retrieval system