KEGG   Mus musculus (mouse): 232827Help
Entry
232827            CDS       T01002                                 

Gene name
Nlrp2, E330007A02Rik, NBS1, Nalp2, PAN1, PYPAF2
Definition
(RefSeq) NLR family, pyrin domain containing 2
  KO
K19409  NACHT, LRR and PYD domains-containing protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    232827 (Nlrp2)
Pattern recognition receptors [BR:mmu04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   232827 (Nlrp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT PYRIN LRR_6 AAA_22 AAA_16 AAA Mg_chelatase RNA_helicase AAA_33 AAA_19 AAA_18 AAA_25 Viral_helicase1 AAA_30 TsaE ATPase_2 AAA_14 AAA_24 KTI12 cobW AAA_28 RuvB_N AAA_5 LRR_4
Motif
Other DBs
NCBI-GeneID: 232827
NCBI-ProteinID: NP_808358
MGI: 3041206
Ensembl: ENSMUSG00000035177
Vega: OTTMUSG00000037748
UniProt: Q4PLS0
Position
7; 7 A1
AA seq 1046 aa AA seqDB search
MEHFDPLGFNLKDVLRKLDKTELNNFKRTLRSCSLPDTMKQINKLTMDLANGAQLAEILT
DHCPSAWIKRVTVQILEEINRVDLAELVVKQIEEAVLKVPEEKVSSKPREPSGTLTFPWN
FVQGAKRPEDKQKEEWKTRYTAKWKQNFWPKCNKEIYVVTESYKTLLALCNPKIETPFAH
AIVLHGPPGSGKTTMAKQLMLEWSESKQAQIFSCAFYISCREVNNTKPCTFAHLLSMDNP
SWRDCVIRDLILGKEFLFVVDGFDELTFPAGALIRDLCGDWNTVKPVEVLLGSLLKRKMA
PHATLLVTTRTQSLHQIFVMMDQPLLVETLGFLEQEKQEYFQKYFEDEEGEEEDKGEGKA
LRALKEVRCNADLYQMASLPTACGIFCLCLELRMKKGEDLSLTCQTYTSMFLNFLCEVFS
SETCEDHLNEEFQILFKKICILAANSLLEQVPILCEEDFLTLKLNLNNLHPMVCRHILFK
DSSSTHCLSFICLGIQQLLAAIIFVQELGQESKGVSKYSIQNMLSREARLKNPDLSGLLP
FVFGLLNETRIQELKTTFGCQISTEVKRKFLECESGENKPLLLLMNMQEILSCLYESQEE
GFVKEAMVLFEDISLHLKTSTDLIHASFCLKNSQNLQTMSLKVEKAVFPENVAALESTAK
HQRSPDEQRMLTFWTDFCDTFNSNKKLVFLDIHESFLNSSALEILCEKLPSASCCLQKVV
LKNISPDDAYEKLCLIFNGYKTISHLILQGGNLDSMHHSLCEVLKNPACNLKFLSLGSCS
TAAQKWDDFFPVLKVNQSLIFLDLTDNSLLDKSAKLLCNIWKEPKCILQRVSLENCQLTE
ACCKDLSSVLMVSRTLTHLSLANNKLGDNGVKNLCESISCTECNLQTLVLWSCNITNAGC
HYLSKMLKQTLSLKHLDLGLNRIGTKGAKFLCEALKNPKSKLKSLWLCGCSITPLNCQDF
SETLRSNKSLNTLDLSQNVLGTDAIKTFCEALKLQICPLQMLRLKFDEAKPSIQNLIQEM
KVSHPQLRISSDQVDLKNPPLPHFIF
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atggaacattttgatcccctgggtttcaacctaaaagacgtcctgagaaagctggacaag
actgagttgaacaatttcaagagaacattgaggagctgttctctgccagatacaatgaaa
cagatcaacaagctgacaatggacctggctaatggagctcagctagcagaaattctcaca
gaccactgccccagtgcttggataaagagagtcaccgtccagatcttagaggaaataaac
cgtgtagatctagctgagttagtagtaaagcaaatcgaagaagcagtattaaaggtacct
gaggaaaaggtttcttctaaaccaagagaaccctcggggacactaactttcccatggaat
tttgttcaaggagctaaaaggccagaggacaagcaaaaagaggaatggaagactagatac
acagctaaatggaagcagaacttctggcctaaatgcaataaagaaatctatgtggttacc
gagagctacaagacactcctggcattgtgtaacccaaagatagaaaccccatttgctcat
gcaattgtgctgcatggccctccaggctctgggaaaaccacaatggcaaagcagctaatg
ttagaatggtcagagagtaagcaggcccagattttctcatgtgccttctacatcagctgc
agggaagtaaataatactaaaccttgcacttttgcccacctcctctccatggacaatccc
tcctggagggactgtgtgattcgagatctaatcctgggaaaggaattcttatttgtggta
gatggttttgatgagctgacattcccagcaggagctctgatccgtgacctttgtggtgac
tggaacacagtgaagcctgtagaggtcttactgggcagtttgctgaagaggaagatggca
cctcatgccaccctgctggtaaccacacggacacagtctttgcaccaaatctttgtcatg
atggatcagccactactagtagaaactctgggcttcttggagcaagaaaagcaggagtac
tttcagaaatactttgaagatgaggagggtgaggaggaggataaaggtgagggaaaggca
cttagagctctcaaggaagtgagatgcaatgctgatctataccaaatggcctcacttcct
actgcatgtgggatattctgcctctgtctggagctaaggatgaagaagggggaagacctg
tctctgacatgtcagacatacacctctatgttcctgaacttcctgtgcgaagtcttctca
tcagaaacctgtgaggaccatctcaatgaggaattccaaatcttattcaagaaaatatgt
atcctggctgccaatagtctcttggaacaggtgcccatactctgtgaagaagacttcttg
acattaaaattgaacctaaacaatttgcatcccatggtgtgcaggcacatcctctttaag
gacagttccagtacacactgtctctctttcatctgcctcggtatccagcaactcctggct
gcaataatatttgttcaggagcttggacaggaaagcaagggtgtctctaaatatagtata
cagaacatgctttcaagggaagcaagattaaaaaaccctgacctgtctgggctgctgcca
tttgtatttggcctcctgaatgagactcgtattcaagagttgaagactacttttggctgc
caaatatcaactgaggtcaagagaaaattcctggagtgtgagtcaggggaaaataaaccc
ttactattactgatgaatatgcaagaaatcttgtcctgtctctatgaatctcaggaggag
gggtttgtgaaggaagccatggtcctctttgaggacatctccttgcatttgaaaaccagc
actgacctcattcatgcttcattctgcctcaagaactctcagaacttgcagacaatgtcc
ctgaaagtagaaaaggcggtctttccagagaatgttgctgcactagagtccacagctaag
catcaaaggtccccggatgaacaacgcatgttaactttctggacagacttttgtgacaca
tttaattcaaataagaaactggtatttctagacatccatgaaagcttcctcaacagctct
gcactggagattctttgtgaaaagctgccctctgcttcctgttgtctccagaaagtggtc
ctcaaaaatatttccccagatgatgcctacgagaaattgtgcctcatttttaatggttat
aaaaccatctcacatctgatcctgcaaggtggcaacctggacagcatgcatcactcactg
tgtgaggttctgaaaaatccagcctgcaacctgaagtttctcagcctgggatcttgttct
actgctgctcagaaatgggatgacttcttcccagtcctgaaagtcaatcaatccctgata
tttctggatctcacagacaacagtctcttggacaaaagtgctaagctcctatgtaatatt
tggaaggaaccaaagtgcatactgcagagggtatcgttggagaactgtcagctcactgaa
gcctgctgcaaggacctctcttccgttttgatggtcagccgaactctgacacacctcagc
ctggccaacaataaacttggggataacggagtgaaaaacctgtgtgaaagcataagctgc
acggagtgcaatctacagaccctggtgctgtggtcctgtaacatcaccaacgctggttgc
cactatctctcaaagatgctcaaacaaacactgagcctgaaacacttggatctggggcta
aatcgcatcggaaccaaaggagcaaagtttctgtgtgaggctttgaagaaccccaagagt
aaattgaaaagtctgtggctgtgtggatgctccatcactccactgaactgccaagacttc
tctgagactcttagaagcaacaagagcctgaacactctagacctgtctcagaacgtcctg
ggaactgatgccataaagacattctgtgaagccttgaaacttcagatttgccccctgcaa
atgcttagattgaaatttgatgaagctaaacctagtatccagaacctgatccaagagatg
aaggtgagccatccacaactgagaatcagcagtgaccaagtggatcttaagaatcctcct
cttcctcatttcattttttga

DBGET integrated database retrieval system