KEGG   Mus musculus (mouse): 232889Help
Entry
232889            CDS       T01002                                 

Gene name
Pla2g4c, D7Ertd445e
Definition
(RefSeq) phospholipase A2, group IVC (cytosolic, calcium-independent)
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00564  Glycerophospholipid metabolism
mmu00565  Ether lipid metabolism
mmu00590  Arachidonic acid metabolism
mmu00591  Linoleic acid metabolism
mmu00592  alpha-Linolenic acid metabolism
mmu01100  Metabolic pathways
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04217  Necroptosis
mmu04270  Vascular smooth muscle contraction
mmu04370  VEGF signaling pathway
mmu04611  Platelet activation
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04724  Glutamatergic synapse
mmu04726  Serotonergic synapse
mmu04730  Long-term depression
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04912  GnRH signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04921  Oxytocin signaling pathway
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    232889 (Pla2g4c)
   00565 Ether lipid metabolism
    232889 (Pla2g4c)
   00590 Arachidonic acid metabolism
    232889 (Pla2g4c)
   00591 Linoleic acid metabolism
    232889 (Pla2g4c)
   00592 alpha-Linolenic acid metabolism
    232889 (Pla2g4c)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    232889 (Pla2g4c)
   04010 MAPK signaling pathway
    232889 (Pla2g4c)
   04370 VEGF signaling pathway
    232889 (Pla2g4c)
   04072 Phospholipase D signaling pathway
    232889 (Pla2g4c)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    232889 (Pla2g4c)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    232889 (Pla2g4c)
   04664 Fc epsilon RI signaling pathway
    232889 (Pla2g4c)
   04666 Fc gamma R-mediated phagocytosis
    232889 (Pla2g4c)
  09152 Endocrine system
   04912 GnRH signaling pathway
    232889 (Pla2g4c)
   04913 Ovarian steroidogenesis
    232889 (Pla2g4c)
   04921 Oxytocin signaling pathway
    232889 (Pla2g4c)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    232889 (Pla2g4c)
  09156 Nervous system
   04724 Glutamatergic synapse
    232889 (Pla2g4c)
   04726 Serotonergic synapse
    232889 (Pla2g4c)
   04730 Long-term depression
    232889 (Pla2g4c)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    232889 (Pla2g4c)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    232889 (Pla2g4c)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     232889 (Pla2g4c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B CvfB_WH Gcn1_N
Motif
Other DBs
NCBI-GeneID: 232889
NCBI-ProteinID: NP_001004762
MGI: 1196403
Ensembl: ENSMUSG00000033847
Vega: OTTMUSG00000036437
UniProt: Q64GA5
Position
7 A1; 7 7.84 cM
AA seq 597 aa AA seqDB search
MELSSGVCPATRLQEAEKAAVHKRSPKVLEALRKLNIQADQAPVIAVLGSGGGLRAHIAC
LGVLSELKELGLLDAVTYLAGVSGSTWALSSLYTKNGNMEGIEEELKHRYEKNEWDFHES
LEKAIQASKRENYSLTDFWAYLIVSRQIRELQDSNLSSLKKQVEEGVLPYPIFAAIDEDL
LADWRERKTQNSWFEFTPHHAGYPALGAYVPITEFGSRFENGKLVKSEPERDLTFLRGLW
GSAFADIKEIKNYILNYFRNPFGKLKFIEGPVTYSEAPRMNVDAMLLDLVMAYFTDMNDP
SIKDKLCALQQALGTETDEFGIEMAEIIQNWNETSAEKKEQFLDHLLDRFKKTQEDTTTY
SLMNWNTGLVWDRCVFVNETRKCVSKWQWGTVYNFLYKHGKIADETMCSRELLHLVDAGF
AINTPYPLVLPPVRETHLILSFDFSAGDPLETIRATADYCQRHEIPFPEVSEDQLKEWAK
APASCYVLRGETGPVVMHFTLFNKDNCGDDIETWRKKYGTVKLSDSYTPDLVRDLLRVSK
ENVKKNKINILSEMRKVAGNPGNIPRVNKEACLGDRVKDPQGSQTVEFKKSHNISKD
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggaactaagctctggggtctgccctgccactagactccaggaagcagaaaaggcagct
gtgcacaaacgcagtcccaaggttttggaggctctacgaaagctcaacatccaagctgac
caggctccagtcattgctgtcttgggctctggcggggggctgcgggcccacatcgcttgt
cttggtgtgctgagtgagctgaaagaacttggcctgttggatgctgtcacatacctcgca
ggggtctctgggtccacttgggcactgtcttcactctacaccaagaatggaaatatggaa
gggatagaagaggagctgaaacatcggtatgagaagaatgagtgggactttcatgagagc
ctggagaaagccatccaggcatcaaagagggagaattactccctgactgacttttgggcc
tatttaattgtttccaggcaaatcagagaacttcaggattcgaatttgtccagtctaaag
aagcaagtggaagaaggagtgctgccctatcccatctttgcagccattgatgaggacctt
ctggctgattggagggagaggaaaactcagaattcctggtttgaattcactcctcatcat
gctggctaccctgcacttggggcttatgtccccatcacagagtttggaagcagatttgag
aatgggaaactggttaaatctgagcctgagagagatttgactttcctgagaggtttatgg
ggaagtgcttttgctgatattaaagaaattaagaattatattttgaactacttcaggaac
ccctttggaaaattgaagtttatagaaggaccagtgacatactcagaagcaccaaggatg
aatgtggatgcaatgctcttggatttagtgatggcttatttcacagatatgaatgacccc
agcatcaaggataagctctgtgcccttcagcaggctctgggtactgagacagatgaattt
ggcatagagatggctgagatcatccagaattggaatgagacctccgcagagaagaaggag
cagtttctcgaccatctgttggatcgcttcaagaagacacaagaagacaccaccacatac
agtttgatgaactggaacacgggtctagtttgggaccgttgcgtttttgtgaatgaaact
cgcaagtgtgtctccaaatggcagtggggaactgtttacaacttcctctataaacacggt
aaaattgcagatgagaccatgtgcagccgagagcttctccatctggtggatgctggtttt
gccatcaacactccctatccacttgttctgcctcctgtgcgtgaaactcacctcatcctc
tcatttgacttcagtgctggggacccactagagaccatcagggccacagcagactactgc
caacgccatgaaatcccctttcctgaggtgagcgaggatcagctgaaggaatgggccaaa
gccccagcaagctgctatgtcctcagaggggaaacaggacctgttgtcatgcactttact
ctgttcaacaaagacaactgtggagatgatattgagacatggagaaaaaaatatgggaca
gtaaaactatctgactcatacacaccagacctggtgagagatttgctgagggtatccaag
gagaatgtgaagaaaaacaaaattaatatcctcagtgagatgaggaaagtggctgggaat
cctgggaacatcccaagagtgaacaaggaggcctgcttgggagacagagtgaaggatccc
caaggctctcagactgtggagtttaagaaatcccacaacatatctaaggattaa

DBGET integrated database retrieval system