KEGG   Mus musculus (house mouse): 232910
Entry
232910            CDS       T01002                                 
Symbol
Ap2s1, AI043088
Name
(RefSeq) adaptor-related protein complex 2, sigma 1 subunit
  KO
K11827  AP-2 complex subunit sigma-1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04144  Endocytosis
mmu04721  Synaptic vesicle cycle
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    232910 (Ap2s1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    232910 (Ap2s1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    232910 (Ap2s1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    232910 (Ap2s1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    232910 (Ap2s1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    232910 (Ap2s1)
SSDB
Motif
Pfam: Clat_adaptor_s
Other DBs
NCBI-GeneID: 232910
NCBI-ProteinID: NP_941015
MGI: 2141861
Ensembl: ENSMUSG00000008036
UniProt: P62743 Q3UJ76
Structure
Position
7:16472369..16483215
AA seq 142 aa
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYR
RYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA
GEIRETSQTKVLKQLLMLQSLE
NT seq 429 nt   +upstreamnt  +downstreamnt
atgatccgattcatccttatccagaaccgggcaggcaagacgcgcctggccaagtggtac
atgcagttcgatgacgacgagaagcagaagctgatcgaggaggtgcacgccgtggtcacc
gtcagggatgccaagcacaccaactttgtggagttccggaacttcaagatcatctaccga
cgctacgctggcctctacttctgcatctgcgtggatgtcaacgacaacaatctggcctat
ctcgaggccatccacaacttcgtagaagtgttaaatgaatacttccacaatgtctgtgaa
ctggacctggtgttcaacttctacaaggtttacacggtggtagatgagatgttcctggca
ggagagatccgagagaccagccagacgaaggtgctgaagcagctgctgatgctgcagtcc
ctggagtga

DBGET integrated database retrieval system