KEGG   Mus musculus (house mouse): 232934
Entry
232934            CDS       T01002                                 
Symbol
Mypop, Myodysa, P42pop
Name
(RefSeq) Myb-related transcription factor, partner of profilin
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Myb_DNA-bind_5 MADF_DNA_bdg Myb_DNA-binding Myb_DNA-bind_6 Myb_DNA-bind_4 TMP_3
Other DBs
NCBI-GeneID: 232934
NCBI-ProteinID: NP_663554
MGI: 2446472
Ensembl: ENSMUSG00000048481
Position
7:18725230..18735691
AA seq 393 aa
MASATAAAAPGEAEETTRLRKPRFSFEENQILIREVRAHYPQLYGAQSRRVSVAERRRVW
DSIATKINGITSWKRTGQEVQKRWNDFKRRTKEKLARVPHSTQGAGPAAEDAFSAEEETI
FAILGPGVAGPGAGSGAEESRAAASSQPQASTASTQRYVLSEDRRQDRRADTPAQSKGGS
SSPESWARPSCNPQEAKERESTSPAAMQPVQLPRLALSPPLPAPPPPPTALAQVAPSSPS
PTPPRPTSAPEQSLDFLRAQQETANAIRELAGTLRQGLAKLSEALSALLPLLPGTPADPL
PPPPPPPPPPPPKPVLPPSAPKVELAPEPVSVVAAVVDGAVVAARGVIISPRSEEGVPKP
LPPAPPLPLHDSPPHKRRKGFPTRKRRGRWKSP
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggcctcggcgaccgcggcggcggcgccgggcgaagcggaggagaccacccgactccgc
aagccgcgcttctccttcgaggagaaccagatcctgatccgagaggtgcgcgcccactac
cctcagctctacggcgcgcagagccgtcgggtgagcgtggccgagcggcggcgagtgtgg
gacagcatcgccaccaaaatcaacggcatcaccagctggaaacgcacgggccaggaggtt
cagaagcgttggaacgacttcaagcgccgcaccaaggagaagctggcccgcgtgccgcat
tccacgcagggcgcggggcccgccgctgaggacgccttctctgcggaggaggagactatt
ttcgccatcctgggaccgggtgtggcggggccgggggctggctctggggctgaggagtcc
cgggcagccgcctcttcacagccgcaggcttcgaccgctagtacacaacggtatgtgttg
tcagaggaccgcaggcaggatcgacgggcagatacaccagcccagagcaagggaggctcc
agcagcccagagtcctgggcccggccctcttgcaatccccaagaagccaaggagcgtgag
tccacgtcccctgcagccatgcagcctgtccagctgccccgcctggccttgtctccaccg
ctccctgcccctccaccaccacccacggcgctggcccaagtggcaccctcatctcctagc
ccaactcctcctcggcccacctcagccccagaacagtccctggacttcctgcgggctcag
caggagactgccaatgctatcagggagctggctggcacccttcggcagggactggccaaa
ctgagcgaggccctcagtgccctgttaccccttttgccgggaaccccagctgacccgctg
cccccgcccccaccgccacctccgcccccacctcccaaaccagtcctgccaccctctgcc
cccaaggtggagctcgccccagagcctgtgtctgtggtagctgctgttgtggatggggct
gtagtggcagcgaggggagtgatcatctcccccaggagcgaggaaggggtgcccaaacca
ctacccccagccccaccacttcccctccacgactcacccccacacaaaaggaggaaaggt
ttccctacacgaaagaggcggggccgctggaagtctccgtga

DBGET integrated database retrieval system