KEGG   Mus musculus (mouse): 232944Help
Entry
232944            CDS       T01002                                 

Gene name
Mark4, 2410090P21Rik, Markl1
Definition
(RefSeq) MAP/microtubule affinity regulating kinase 4
  KO
K08798  MAP/microtubule affinity-regulating kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    232944 (Mark4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    232944 (Mark4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     232944 (Mark4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   232944 (Mark4)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     232944 (Mark4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr KA1 UBA Kinase-like Kdo RIO1 UBA_2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 232944
NCBI-ProteinID: NP_758483
MGI: 1920955
Ensembl: ENSMUSG00000030397
Vega: OTTMUSG00000059238
UniProt: Q8CIP4
Position
7; 7 A3
AA seq 752 aa AA seqDB search
MSSRTALAPGNDRNSDTHGTLGSGRSSDKGPSWSSRSLGARCRNSIASCPEEQPHVGNYR
LLRTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPSSLQKLFREVRIMKGLNHPNIVK
LFEVIETEKTLYLVMEYASAGEVFDYLVSHGRMKEKEARAKFRQIVSAVHYCHQKNIVHR
DLKAENLLLDAEANIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDIW
SLGVILYTLVSGSLPFDGHNLKELRERVLRGKYRVPFYMSTDCESILRRFLVLNPAKRCT
LEQIMKDKWINIGYEGEELKPYTEPEEDFGDTKRIEVMVGMGYTREEIKEALTNQKYNEV
TATYLLLGRKTEEGGDRGAPGLALARVRAPSDTTNGTSSSKGSSHNKGQRASSSTYHRQR
RHSDFCGPSPAPLHPKRSPTSTGDTELKEERMPGRKASCSAVGSGSRGLPPSSPMVSSAH
NPNKAEIPERRKDSTSTPNNLPPSMMTRRNTYVCTERPGSERPSLLPNGKENSSGTSRVP
PASPSSHSLAPPSGERSRLARGSTIRSTFHGGQVRDRRAGSGSGGGVQNGPPASPTLAHE
AAPLPSGRPRPTTNLFTKLTSKLTRRVTDEPERIGGPEVTSCHLPWDKTETAPRLLRFPW
SVKLTSSRPPEALMAALRQATAAARCRCRQPQPFLLACLHGGAGGPEPLSHFEVEVCQLP
RPGLRGVLFRRVAGTALAFRTLVTRISNDLEL
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgaggacggcgctggccccgggcaacgatcgaaactcggacacgcatggcaca
ttgggcagtggacgatcttcggacaaagggccgtcctggtccagccgttccctgggtgcc
cgttgccggaactctatcgcttcctgccctgaggaacaaccccatgtgggcaactatagg
ctgctaaggaccatcgggaagggcaacttcgccaaagtcaagctggctcggcatatcctc
acgggccgggaggtcgctattaagatcattgataagacccagctgaaccccagtagcttg
cagaagctgttcagagaagtccgaattatgaagggactcaaccaccccaacatcgtgaag
ctttttgaggtgatagagacggagaagacgctatacctggtgatggaatacgctagcgca
ggagaagtgtttgactacctcgtgtcgcacggccgcatgaaggagaaggaggctcgagcc
aagttccggcagatcgtgtcagccgtgcactactgtcatcagaagaacattgtacacagg
gatctaaaggctgaaaacctgttgctggatgccgaggccaacatcaaaatcgccgacttc
ggcttcagcaatgagttcacgctgggctccaagctggacaccttctgtgggagcccccca
tacgccgccccagagctgttccagggcaagaagtatgatgggccagaggtggacatctgg
agcctgggtgtcatcctgtacacgctggtcagcggctccctgcccttcgatgggcacaac
ctcaaggagctgcgggagcgagtcctcagaggaaagtaccgggtccccttctacatgtct
acagactgcgagagcattctgcggagatttctggtgctgaaccccgcaaaacgctgtact
ctggagcaaatcatgaaagacaaatggatcaacatcggctatgagggtgaggagctgaag
ccatacacggagcctgaggaggacttcggggacaccaagagaattgaggtgatggtgggt
atgggctacacacgggaagaaatcaaagaggccttgaccaaccagaagtacaacgaggtg
accgccacctacctcctgctgggcaggaagactgaggagggtggggaccggggtgcccca
gggctggccctggcacgggtgcgggcgcccagcgacaccaccaacgggacaagctccagc
aaaggcagcagccacaacaaagggcaacgggcttcttcctccacctaccaccgccagcgc
cgtcacagtgacttctgtggcccgtcccctgccccgctgcacccgaagcgcagcccaacc
agcacgggagacacggagctcaaagaagagcggatgccgggtcggaaagcgagctgcagt
gcagtgggcagtggaagtcgaggcttgcccccctccagccccatggtcagcagtgcccac
aaccccaataaggcagagatccctgagcggcggaaggacagcactagcacccctaacaac
ctcccccccagcatgatgacccgaagaaacacctatgtgtgcacagagcgaccaggatct
gaacgcccgtccttgttgccaaatggcaaagaaaatagctccggtacctcgcgggtgccc
cctgcctcgccttccagtcatagcctggctcccccgtcaggcgagcggagccgcctggct
cggggctccaccatccgcagcaccttccatgggggccaggtccgagaccggcgggcaggg
agcgggagtggcgggggtgtgcagaatggacccccagcctcacccacgcttgcccacgag
gccgcacccctgccctccgggcggcctcgccccaccaccaacctcttcaccaagctgacc
tccaaactgacccgaagggtcacagacgaacctgagagaatcgggggacctgaggtcaca
agttgccatctaccttgggataaaacggaaaccgcccccaggctgctccgattcccctgg
agtgtgaagctgaccagctcgcgacctcctgaggccctgatggctgccctgcgacaggcc
acagcggccgcccgctgccggtgccgccagccgcagccgttcctgctggcctgcctgcac
gggggtgcgggcgggcccgagcccctgtcccatttcgaagtggaggtgtgccagctgccc
cggcccggcctcaggggcgtcctcttccgccgtgtggcgggcaccgccctggccttccgc
accctcgtcacccgcatctccaacgacctcgaactctga

DBGET integrated database retrieval system