KEGG   Mus musculus (house mouse): 232984
Entry
232984            CDS       T01002                                 
Symbol
B3gnt8, B3galt7, B7galt7, BC025206
Name
(RefSeq) UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8
  KO
K09665  beta-1,3-N-acetylglucosaminyltransferase 8 [EC:2.4.1.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    232984 (B3gnt8)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-
     232984 (B3gnt8)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   232984 (B3gnt8)
SSDB
Motif
Pfam: Galactosyl_T Fringe
Other DBs
NCBI-GeneID: 232984
NCBI-ProteinID: NP_001031817
MGI: 2385269
Ensembl: ENSMUSG00000059479
UniProt: Q8R3I9
Position
7:25327025..25328917
AA seq 389 aa
MRCRKCQLCLSALLTLLGLKVYIEWTSESWLKKAEPRGALPSPTPPNAEPTLPTNLSARL
GQTGPLSSAYWNQQQRQLGVLPSTDCQTWGTVAASEILDFILYPQELRRFLLSAACRSFP
LWLPAGEGSPVASCSDKDVPYLLLAVKSEPGHFAARQAVRETWGSPVAGTRLLFLLGSPL
GMGGPDLRSLVTWESRRYGDLLLWDFLDVPYNRTLKDLLLLTWLSHHCPDVNFVLQVQDD
AFVHIPALLEHLQTLPPTWARSLYLGEIFTQAKPLRKPGGPFYVPKTFFEGDYPAYASGG
GYVISGRLAPWLLQAAARVAPFPFDDVYTGFCFRALGLAPRAHPGFLTAWPAERTRDPCA
VRGLLLVHPVSPQDTIWLWRHLWVPELQC
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgcgttgccgcaagtgccagctctgcctgtcagcactgctcacactcctgggcctcaaa
gtatacatcgagtggacatccgagtcctggcttaaaaaggctgaaccccggggcgctctg
cccagtcccacaccacccaatgctgagcccactctgcccaccaacctctcagcacgcctg
ggtcagactggcccactgtcctctgcttactggaaccagcagcagcggcagctgggagtc
ctgcccagtacggactgtcagacttgggggactgttgctgcctcggagatcttggacttc
atcctgtacccccaggagcttcggcgcttcttgctgtcggcggcctgtaggagctttcca
ctatggctgcctgcaggagaaggcagccctgtggccagctgctctgataaggatgtaccc
tacttgctactggctgtcaaatcagaaccaggacactttgcagcacggcaggctgtgagg
gagacctggggcagcccagttgctgggacccggttgctcttcctgctggggtccccccta
ggaatgggggggcctgacttaagatcactggtgacgtgggaaagccggcgctatggtgac
ctactgctctgggacttcctggatgttccctacaaccggacactcaaggacctgctgctg
ctgacctggctgagccaccactgccccgatgtcaattttgtcctgcaggttcaggatgat
gcctttgtgcacatcccagccctactggagcacctgcagactctgccacccacctgggcc
cgcagcctctacctgggtgagatcttcacccaggccaaaccgctccgcaagcccggagga
cccttctatgtgccgaagaccttctttgaaggggactatccagcctatgcgagtggaggt
ggctatgtaatctcaggacgcctggcaccctggctgctgcaggcggcagctcgcgtggca
cccttcccctttgatgatgtctacactggcttctgcttccgtgccctgggcttagcaccc
cgtgcccatccaggcttcctcacagcctggccagcagaacgtaccagggacccctgcgcc
gtgcgaggcctgctcttggtgcatccagtcagccctcaggacaccatttggctctggaga
catctgtgggtcccagagctccagtgctga

DBGET integrated database retrieval system