KEGG   Mus musculus (mouse): 233001
Entry
233001            CDS       T01002                                 

Symbol
Nlrp9a, D7Ertd565, D7Ertd565e, N, Nalp-, Nalp-theta, Nalp9a
Name
(RefSeq) NLR family, pyrin domain containing 9A
  KO
K22663  NACHT, LRR and PYD domains-containing protein 9
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    233001 (Nlrp9a)
Pattern recognition receptors [BR:mmu04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   233001 (Nlrp9a)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 AAA_22 AAA_14
Other DBs
NCBI-GeneID: 233001
NCBI-ProteinID: NP_001041685
MGI: 2675292
Ensembl: ENSMUSG00000054102
Vega: OTTMUSG00000031796
UniProt: Q66X03 E9QKM4
Position
7 A3; 7 15.08 cM
AA seq 949 aa
MMDSSGYGLLQYLQKLSDEEFQRFKEHLRKEPEKFKLKPISWTKIKNTSKEDLVMQLYTH
YPGKAWDMVLSLFLQVNREDLSTMAQTERRDKQTKYKEFMKNTFQHIWTMETNTYIPDRS
YHEFIEVQYRALQDIFDCESEPVTVVVSGSRGGGKTTFLRKAMLDWASRNLLQNRFQYVF
YFSVFSLNNITELSLAELISSTLPESSETVDDILSDPKRILFILDGFDYLKFDLELRTNL
CNDWRKKLPIQIVLSSLLQKIMLPECSLLLELGNASLSNIIPLLQYPREIIMSGFSEQTI
EIYCVSFFNTQTGVEIFKNLKSIKPLFNLCRCPHLCWMICSTIKWQYERREVASRFGRTL
GLLYTIFMVSAFKSTYARNPSKQNRARIRTLCTLAVEGMWKQVYVFDSDDLRRNGISESD
KKVWLRMKFLQNQGSNIVFYHSTLQWYFAVLFYFLQYKDTRHPVIGNLAQLLGEIYAHKQ
NQWFHTRILLFGMATEQVNSLLEPCFGCISSKEVRQEIIRYIKSLSQQECNEKLVVHPQN
LFFCILDNQEERFVRQLMDRFEEMTVDISDVDDMSATPYCLHRAPKVKNLHLHIQKRVFL
EIHDPEYGDLELFKLDQKCSFTTNFGDGLLFCTFLHLPHLKYMNLYGTNLSNDAVERLCS
ALKFSTCGVEELLLGKCDISSEACGIIAASLINSEVKHLSLVENPLKNKGVMSLCEMLKD
PSCVLESLMLSYCCLTFIACGHLYEALLSNEHLSLLDLGSNFLEDTGVNLLCEALKDPNC
TLKELWLPGCYLTSECCEEISAVLTCNTNLKTLKLGNNNIQDTGVKRLCEALCHPNCEMQ
CLGLDMCDFTSDCCEDLALVLTTCNTLKSLNLDWNAFDHSGLEMLCKALNHKACNLEVLG
LDKSLFSEESQTLLQAVEKKNKNLKVLHFPWLKEELEKRGVRLVWNSKN
NT seq 2850 nt   +upstreamnt  +downstreamnt
atgatggactcatctgggtatggcttgctgcagtatttgcaaaagctcagtgatgaagag
ttccagagatttaaagaacatctcaggaaagagccagagaaatttaaacttaaacctatc
tcctggactaagatcaaaaacacttccaaagaagacctggtaatgcaattgtacacacat
tatccaggaaaggcatgggatatggtgttgagcctgtttctacaggtcaatcgggaagac
ctctcaaccatggctcagacagaaaggagagataaacaaactaaatacaaagagtttatg
aagaatacatttcagcacatatggacaatggagaccaacacttatatacctgatagaagc
taccacgaatttatagaagtccagtacagagcattgcaggacatatttgattgtgagtca
gagccagtcactgtagttgtatcaggttctagaggaggaggtaaaactactttcttaaga
aaagcaatgttggattgggcatcaagaaatttactgcagaaccgatttcaatatgttttc
tacttctccgtcttctcacttaacaatatcacagagttaagcttagctgagcttatctca
agtacgttgcctgaatcttcagagacagtggatgatattttatctgatccaaaaagaatc
ttgtttatcctggatggatttgattacctgaaatttgacttggaactcaggacaaacctg
tgcaatgactggaggaagaagctgccaatacaaattgtcttgagtagtttgctacagaaa
ataatgctcccagaatgttctctgctccttgaattgggaaatgcaagtctttcaaacatt
attcctttgctgcaatatccaagggagataattatgtcaggattctctgaacaaactata
gaaatctactgtgtgtctttctttaatacccagacaggtgtagaaatctttaagaattta
aagagcattaaaccattgttcaatttatgccgctgtcctcatctatgctggatgatctgt
agtactataaagtggcagtatgagaggagagaggtagcaagtcgttttggtcgaacatta
ggactcctctacacaatatttatggttagcgcatttaaatcaacatatgccaggaatcca
tctaaacagaacagggcccgtataaggaccctatgcaccttggctgtagagggaatgtgg
aaacaggtatatgtgtttgactctgatgacctcaggaggaatgggatatctgaatcagat
aagaaagtgtggctgagaatgaaatttctccagaatcaaggtagcaacattgtattttat
cattctacactacagtggtactttgctgtgctgttctattttctccaatacaaagacaca
cgtcacccagttattggaaacctcgctcaactcctaggagaaatctatgctcataaacag
aaccaatggttccacacacggatattattgtttggaatggccactgagcaagttaactcc
ttgcttgaaccatgctttggctgtatatcatccaaggaggtaagacaggaaatcatcaga
tacatcaaaagtctcagtcaacaagaatgcaatgaaaaactggtggtgcatccccagaat
ttgtttttctgtatacttgacaaccaggaggaaagatttgtaagacaattgatggatcga
tttgaagaaatgactgttgatattagtgatgttgatgatatgtcagcaactccatattgt
ctgcatagagccccaaaagtgaaaaaccttcacctgcatatacaaaagagagttttttta
gaaatccatgatccagaatatggtgacttagaactctttaaactcgaccaaaagtgttcc
ttcacgactaactttggagatggtttattattttgcacatttcttcacctacctcacctg
aaatacatgaacctgtatggcactaatctctctaatgatgcagttgagaggctgtgctca
gctctgaaattttcaacatgtggagtggaggagctgttgttgggaaaatgtgacatatca
agtgaggcttgtggcataattgcagcttcccttatcaattctgaggtgaaacatctctca
ttggttgaaaatcccttgaagaacaaaggagtgatgtcactgtgtgaaatgctgaaggat
ccaagctgtgtcctggaatcactgatgttgtcttactgctgtctcacattcattgcctgt
ggacatctctatgaagctcttttgagcaatgaacacctctctctgcttgatctggggtca
aatttcctggaagacactggagtgaaccttctgtgtgaagctttgaaagatccaaactgc
accctcaaggagttatggttgcctggttgctatttaacttcagaatgttgtgaagagatc
tcggctgtcctgacttgcaatacaaatctaaagaccctgaaacttggcaacaataacata
caagacactggtgtcaaacggttatgtgaagctctgtgtcatcctaactgtgaaatgcag
tgtcttgggttagacatgtgtgacttcaccagtgactgttgtgaagacctggccttggtt
cttaccacctgcaacacattgaagagcttaaaccttgactggaatgcctttgaccattct
gggctggagatgctctgtaaggccttgaatcacaaagcctgtaacctggaggtgcttgga
ctggacaaatctttattttctgaggaatcacagacattactgcaagctgtggaaaagaaa
aataaaaatctgaaagttttgcattttccctggcttaaagaggaactcgaaaagaggggt
gttcgtctggtatggaacagcaagaattga

DBGET integrated database retrieval system