KEGG   Mus musculus (mouse): 233020
Entry
233020            CDS       T01002                                 

Gene name
Hipk4, Gm162
Definition
(RefSeq) homeodomain interacting protein kinase 4
  KO
K08826  homeodomain interacting protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    233020 (Hipk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    233020 (Hipk4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     233020 (Hipk4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   233020 (Hipk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like Kdo Pox_ser-thr_kin RIO1 HSM3_N
Other DBs
NCBI-GeneID: 233020
NCBI-ProteinID: NP_001028487
MGI: 2685008
Ensembl: ENSMUSG00000040424
Vega: OTTMUSG00000022752
UniProt: Q3V016
Position
7; 7 A3
AA seq 616 aa
MATIQSETDCYDIIEVLGKGTFGEVAKGWRRSTGEMVAIKILKNDAYRSRIIKNELKLLR
CVRGLDPDEAHVIRFLEFFHDALKFYLVFELLEQNLFEFQKENNFAPLPARHIRTVTLQV
LRALARLKELAIIHADLKPENIMLVDQTRCPFRVKVIDFGSASIFSEVRYVKEPYIQSRF
YRAPEILLGLPFCEKVDVWSLGCVMAELHLGWPLYPGNNEYDQVRYICETQGLPKPHLLH
AARKAHHFFKRNPHPDATNPWQLKSSADYLAETKVRPLERRKYMLKSLDQIETVNGGGAV
SRLSFPDREALAEHADLKSMVELIKRMLTWESHERISPSAALRHPFVSMQQLRSAHEATR
YYQLSLRGCRLSLQVDGKPPPPVIASAEDGPPYYRLAEEEETAGLGGVTGSGSFFREDKA
PGMQRAIDQLDDLSLQEARRGLWSDTRADMVSDMLVPLKVASTSHRVPDSGPEPILAFYG
SRLTGRHKARKAPAGSKSDSNFSNLIRLSQASPEDAGPCRGSGWEEGEGRTTSTEPSVIP
QREGDGPGIKDRPMDAERPGPELFDPSSCPGEWLSEPEWTLEGIRGSRAQGLPAHHPHPH
GPPRTTSFLQHVGGHH
NT seq 1851 nt   +upstreamnt  +downstreamnt
atggccaccatccagtcagagactgactgctacgacatcattgaagttctgggcaagggc
acttttggagaggtggccaagggctggcgtcggagtacaggtgaaatggtggccatcaag
atcctgaagaacgatgcgtaccgaagccgcatcatcaagaatgagctgaagctgctgcgc
tgcgtgcgaggcctggaccctgacgaggcccacgttatccgcttccttgagttcttccac
gatgccctcaagttctacctggtcttcgagcttttggagcaaaacctctttgagttccag
aaagagaacaacttcgcaccccttcctgccaggcacatccgcacggtcacactgcaggta
ctaagagcgctggcccggctcaaggaactggccatcatccacgctgacctcaagcctgaa
aacattatgttggtagaccagacgcgctgccccttcagggtcaaggtgatcgactttggc
tcggccagcatattcagtgaggtacgctatgtgaaggagccttacatccagtcccgcttc
tacagggccccagagatcctgctggggctgcccttctgtgagaaggtggacgtgtggtct
ctgggctgtgtcatggccgagctacatctgggctggcctctctacccaggcaacaatgag
tatgaccaggtgcgctacatctgtgagacccagggcttacccaagccccatttgctgcat
gcggctcgcaaggctcaccacttcttcaagcgtaacccccaccccgatgccaccaacccc
tggcagctgaagtcctctgctgactacctagctgagaccaaggtacgtcctctggagcgc
cgcaagtacatgctcaaatccttggaccagattgagacagtgaatggtggtggagctgtg
agccggctgagttttccagaccgggaggccctggcggaacacgcagacctcaagagcatg
gtggagctgatcaaacgcatgctgacatgggagtcgcacgaacgcatcagtcccagtgcg
gccctgcgtcaccccttcgtgtccatgcagcagctgcggagtgcccacgaggccacccgc
tactaccagctgtcgctcagaggctgtcggctgtccctgcaggtggatggcaagccaccc
ccacctgtcatagccagcgcagaggacgggcctccctactaccgcctggctgaggaggag
gagactgcaggcctgggtggtgtgacaggcagtgggtccttcttcagggaggacaaggct
ccgggaatgcagagggccatcgaccagctcgatgacctgagtctgcaagaggccagacgg
gggctgtggagcgacacacgggccgacatggtctctgacatgctggttccactcaaagtg
gccagtaccagccaccgagtccctgactcaggcccagagcctatcctggccttctacggc
agccgattgaccggccgccataaggcccgcaaggccccagcaggctccaaatctgactcc
aacttcagtaacctcattcggctgagccaggcctcacctgaggatgccgggccctgtcgg
ggcagtggctgggaggaaggagaaggccgcacgacctccacagagccgtctgtcatccca
caacgggaaggagatgggcctggcatcaaagacaggcccatggatgccgagaggccaggc
cctgagctctttgatcccagcagctgtcctggagagtggctgagtgagccagaatggacc
ctagagggcatccgggggtctcgagctcaagggctcccagctcaccatccccacccccac
gggccacccaggaccaccagctttctgcagcatgttggagggcaccactga

DBGET integrated database retrieval system