KEGG   Mus musculus (house mouse): 233058
Entry
233058            CDS       T01002                                 
Symbol
Zfp420, B230119D13, B230312I18Rik, mszf59-1, mszf70
Name
(RefSeq) zinc finger protein 420
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    233058 (Zfp420)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    233058 (Zfp420)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    233058 (Zfp420)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 XPA_N Zn-ribbon_8 zf_UBZ zf-met C1_4 zinc_ribbon_15 zf-C2H2_11 DUF5830 Zn_ribbon_SprT HVO_2753_ZBP
Other DBs
NCBI-GeneID: 233058
NCBI-ProteinID: NP_001351547
MGI: 2444666
Ensembl: ENSMUSG00000058402
Position
7:29559392..29576727
AA seq 578 aa
MVTHDTMSVFCPGTRLPQHPRGYSTEKPYKCEECGKAFRRASHLSQHQSIHTGEKPYECK
QCGKAFSRDSQLSLHQRLHTGEKPYTCKECGKAFTQSSQLILHHRIHTGEKPYKCEACGK
AFIRSSQLSRHQKVHTGEKPFECKECGKAFTQNSQLTLHQRLHTGEKLYDCKECRKVFTQ
LSQLILHRRIHTGEKPYECNECGKAFICGSQLSQHRKIHNGEKPYECKECGKAFIRGSLL
MQHQRIHTGEKPYKCDECGKAFIRGSQLTQHQRVHTNEKPYECKECGKTFSHGSQLTQHQ
RIHTGEKPYQCKECGKAFNRGSLLTRHQRIHTGEKPYKCKECGKNFSRGSELTQHERIHT
GEKPYECKECGKSFIRGSQLTQHQRIHTGEKPYECKECRMAFTQSSHLSQHQRLHTGEKP
YVCSECGKAFARGLLLIQHQRIHTGEKPYQCRECGKAFIRSSQLTQHQRTHTGEKPYECR
ECGKAFGHGSQLTLHQRVHTGEKPYECKECRKAFTQSSHLSRHQRVHTGEKPYQCKECEK
AFTRESQLMRHQRIHIRGKSLDCKECRIDFNHHSQIFI
NT seq 1737 nt   +upstreamnt  +downstreamnt
atggtaacacatgacacaatgtccgttttctgcccaggcacgcgcctacctcagcatcca
cggggttactctacagagaagccctataaatgtgaggagtgtggcaaagccttcaggcga
gcctcacacctgtcccagcatcagagtattcacactggtgagaaaccctatgaatgtaag
cagtgtgggaaggcctttagtcgtgattcccagctaagtcttcatcagagacttcacacc
ggtgagaaaccctacacatgcaaggaatgtggaaaggctttcactcaaagctcacaactt
attttgcaccatagaattcatacgggtgagaaaccatacaagtgtgaagcctgtgggaag
gcctttattcgaagctcacaactcagccgccatcaaaaggtccacactggagagaaaccc
tttgaatgtaaagagtgtgggaaggccttcacccagaactcacaacttactctgcaccag
agactgcacactggtgagaagctctacgactgtaaggagtgtaggaaggtctttactcag
ctctcgcagcttattctccatagaagaatccacactggcgagaaaccctatgaatgcaat
gagtgtgggaaagctttcatttgtggctcacagctctcgcagcaccggaaaatccacaat
ggagaaaagccatatgaatgtaaggagtgtgggaaggcttttattcgaggctcactactt
atgcaacatcaaaggattcacactggtgaaaaaccctataaatgtgacgagtgtggaaag
gcttttatccgtggttcccaactcactcaacatcagagggttcatactaacgaaaagcct
tacgaatgtaaagaatgtggaaagaccttcagtcatggctcacaactaactcaacatcag
agaatccatactggtgagaagccctatcaatgtaaggagtgtgggaaagcctttaatcgc
gggtcactccttactcgacatcagaggattcacaccggtgaaaaaccctacaaatgtaaa
gaatgtggaaaaaattttagccggggctcagaacttactcagcatgagagaatccacacg
ggtgagaagccctatgagtgtaaggaatgtgggaagtcctttatccgtggctcccagctc
actcagcatcaaagaatccacacaggtgaaaaaccgtatgagtgtaaagaatgccgaatg
gcctttacccagagttcacatctttcccagcatcagagacttcataccggtgagaaaccc
tacgtgtgtagcgaatgtgggaaggcctttgcacgtggattgttgctcatacagcatcag
agaattcatactggcgagaagccgtatcagtgtagggaatgtgggaaggcttttatccgc
agttcacagctcactcaacatcagcgaactcacactggagagaaaccttatgaatgtagg
gaatgtgggaaggcctttggtcatggctctcaacttactctgcatcagagggtccacaca
ggtgagaagccctatgaatgtaaggagtgtagaaaggccttcactcagagttcacatctt
tctcggcaccaacgagttcatactggcgagaaaccgtatcagtgtaaagaatgtgaaaag
gcctttacacgtgagtctcaactaatgcgacatcagagaattcatatccgtggcaaatct
ttggactgtaaggaatgccgaatagactttaatcatcattcgcaaatttttatatga

DBGET integrated database retrieval system