KEGG   Mus musculus (house mouse): 233066
Entry
233066            CDS       T01002                                 
Symbol
Syne4, 0610012K07Rik, AI428936, KASH4, Nesp4
Name
(RefSeq) spectrin repeat containing, nuclear envelope family member 4
  KO
K23401  nesprin-4
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    233066 (Syne4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   LINC complex
    233066 (Syne4)
SSDB
Motif
Pfam: KASH Spectrin Gyro_capsid
Other DBs
NCBI-GeneID: 233066
NCBI-ProteinID: NP_705805
MGI: 2141950
Ensembl: ENSMUSG00000019737
Vega: OTTMUSG00000040160
UniProt: Q8CII8
Position
7:30014241..30018470
AA seq 388 aa
MALVPPLGREFPPEPVNCPLAAPRELDVVGGTICPAPEEETSRPEQVQASLGLPEHCMGE
LKSTESATSPSRLPLASSHEHQDGGKPCEHSDSGLEVLEAEQDSLHLCLLRLNFRLQDLE
RGLGSWTLAHNRIVQMQALQAELRGAAERVDALLAFGEGLAERSEPRAWASLEQVLRALG
THRDTIFQRLWQLQAQLISYSLVLEKANLLDQDLEVEGDSDGPAAGGVWGPWAPSTFPTP
AELEWDPAGDVGGLGPSGQKISRIPGAPCELCGYRGPQSSGQGLEDLLSLGLGHRKHLAA
HHRRRLRKPQDRKRQVSPSLPDAMLEVDRGVPAPASKRPLTLFFLLLFLLLVGATLLLPL
SGVSCCSHARLARTPYLVLSYVNGLPPI
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggccctggttccacctcttggccgtgaattcccgccagagcctgtgaattgtcccctg
gcagctcctagagagctggatgttgtcggagggaccatctgccctgcacctgaggaagag
acaagcaggccagagcaggtccaggcctccttgggcctgcctgagcattgcatgggtgaa
ctgaagagcactgagtctgccaccagcccctcaagactccccctggcctcttcccatgag
catcaagacgggggcaagccctgtgagcactctgactctggtttggaagtactagaagct
gaacaggacagtctacatctttgtctgttgaggttgaacttccggctgcaggacctggaa
cgaggccttgggtcttggacgctggcccacaacaggattgtccagatgcaggccctgcag
gcagagctacgaggggccgctgagcgcgtggatgcattgcttgcatttggtgagggcctg
gcagagaggagtgagcccagggcctgggcatccctggagcaggtcctgagggcccttgga
acccaccgagacaccatcttccaacggctctggcagctgcaggcccagttgatcagctat
agcctggtgcttgagaaggccaacctcctggaccaggacttggaagttgagggagactca
gacgggccagcagctggtggagtctgggggccctgggcacccagtaccttccccactcct
gcagagttggagtgggacccagcaggggatgttgggggtcttgggccctcagggcaaaag
atatctcggataccaggagctccctgtgagctgtgtggctacaggggaccccagagcagt
ggacagggccttgaggacctgctctccttggggcttggccaccggaaacatttagcggct
caccatcgaaggcggctccggaagcctcaggacaggaagaggcaagtatcccccagtctg
cctgatgcaatgctggaagtggatcgcggggtcccagctcctgcatccaagcggcccctg
accctcttctttctccttctcttcctccttctggtgggtgccacgctgttgctgcccttg
tcgggggtctcctgctgttctcatgcccggctggctaggacgccctacctggtgctcagt
tatgtcaatggtctccctccaatctga

DBGET integrated database retrieval system