KEGG   Mus musculus (mouse): 233079Help
Entry
233079            CDS       T01002                                 

Gene name
Ffar2, GPCR43, Gpr43
Definition
(RefSeq) free fatty acid receptor 2
  KO
K04328  free fatty acid receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    233079 (Ffar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    233079 (Ffar2)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Free fatty acid
    233079 (Ffar2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srx TAS2R
Motif
Other DBs
NCBI-GeneID: 233079
NCBI-ProteinID: NP_001161981
MGI: 2441731
Ensembl: ENSMUSG00000051314
Vega: OTTMUSG00000049767
UniProt: Q8VCK6
Position
7; 7 B1
AA seq 330 aa AA seqDB search
MTPDWHSSLILTAYILIFLTGLPANLLALRAFMGRVRQPQPAPVHILLLNLTLADLLLLL
LLPFRIVEAASNFRWYLPKIVCALTGFGFYSSIYCSTWLLAGISMERYLGVAFPVQYKLS
RRPLYGVIAALVAWIMSFGHCTIVIIVQYLNSTEQVGTENQITCYENFTQEQLDVVLPVR
LELCLVLFFVPMAVTIFCYWRFVWIMLTQPHVGAQRRRRAVGLAVVTLLNFLVCFGPYNM
SHLVGFYLRQSPSWRVEAVVFSSLNASLDPLLFYFSSSVVRRAFGKGLLLIRNPASSMLG
RGAKETVEGTKMDRGGSQAEGVQSSEFVTE
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaccccagactggcacagttccttgatcctcacggcctacatcctcatctttcttact
gggctccctgccaacctgctggccctgcgggccttcatgggccgggttcgccagcctcag
cctgcccctgtgcacatcctcctgcttaatctgaccctggcggacttgctcctgttgctg
ctgctgcccttccggatcgtggaagcagcatccaacttccgctggtacctaccaaagatc
gtgtgcgcgctgacaggcttcggcttctacagcagcatctactgcagcacgtggctgctg
gcgggcatcagcatggaacgctacctgggagtggccttcccggtgcagtacaagttatcc
cgccggccactgtatggagtgatcgctgctctggtggcctggatcatgtcctttggccac
tgcaccatcgtcatcatcgttcagtacctgaactcaactgagcaggtgggcactgagaac
caaataacctgctacgagaacttcacccaagagcagctggatgtggtactgcccgtacga
ctggagctgtgcctggtcctgtttttcgttcccatggcagtcaccatcttctgttattgg
cgcttcgtgtggatcatgctcacgcagccccacgttggggctcagaggcgacgccgggca
gtgggcctggctgttgtgacgcttcttaatttcctggtgtgctttggaccctacaacatg
tcccacctggtggggttctacctgaggcagagcccctcgtggcgggtggaggctgtggtg
ttcagttccctcaatgccagcctggatccattattgttctacttctcctcctccgtggtg
cgcagagcttttgggaaaggtttgctactgatccgcaatcctgcctcctctatgctgggc
aggggagccaaagagacagtggaggggaccaagatggacaggggtggaagtcaagcagaa
ggggtacagagttctgaatttgtcaccgagtag

DBGET integrated database retrieval system