KEGG   Mus musculus (mouse): 233081Help
Entry
233081            CDS       T01002                                 

Gene name
Ffar1, Gpr40
Definition
(RefSeq) free fatty acid receptor 1
  KO
K04325  free fatty acid receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    233081 (Ffar1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    233081 (Ffar1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Free fatty acid
    233081 (Ffar1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Cytochrome_B
Motif
Other DBs
NCBI-GeneID: 233081
NCBI-ProteinID: NP_918946
MGI: 2684079
Ensembl: ENSMUSG00000044453
Vega: OTTMUSG00000049770
UniProt: Q76JU9
Position
7; 7 B1
AA seq 300 aa AA seqDB search
MDLPPQLSFALYVSAFALGFPLNLLAIRGAVSHAKLRLTPSLVYTLHLGCSDLLLAITLP
LKAVEALASGAWPLPLPFCPVFALAHFAPLYAGGGFLAALSAGRYLGAAFPFGYQAIRRP
RYSWGVCVAIWALVLCHLGLALGLETSGSWLDNSTSSLGINIPVNGSPVCLEAWDPDSAR
PARLSFSILLFFLPLVITAFCYVGCLRALVRSGLSHKRKLRAAWVAGGALLTLLLCLGPY
NASNVASFINPDLGGSWRKLGLITGAWSVVLNPLVTGYLGTGPGRGTICVTRTQRGTIQK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccccacagctctccttcgctctctatgtatctgcctttgcgctgggcttt
ccattgaacttgttagccatccgaggcgcagtgtcccacgctaaactgcgactcactccc
agcttggtctacactctccatctgggctgctctgatctcctactggccatcactctgccc
ctgaaggctgtggaggccctggcttctggagcctggcccctgccgctccccttctgccca
gtctttgccttggcccactttgctcccctctacgcaggcggaggcttcctagctgctctc
agcgctggccgctacctgggggctgccttccccttcgggtaccaagccatccggaggccc
cgctattcctggggtgtgtgtgtggctatatgggcccttgtcctctgccacctggggctg
gcccttggcttggagacttccggaagctggctggacaacagtaccagttccctgggcatc
aacatacccgtgaatggctccccggtctgcctggaagcctgggatcccgactctgcccgc
cctgcccgtctcagtttctccattctgctcttctttctgcccttggtcatcactgccttc
tgctatgtgggctgcctccgggccctggtgcgctcaggcctgagccacaaacggaagctc
agggcagcttgggtggccggaggcgctctcctcacactcctgctctgcctggggccctat
aatgcctccaatgtggctagtttcataaacccggacctaggaggctcctggaggaagtta
ggactcatcacaggggcctggagtgtggtactcaacccactggtcactggctacttggga
acaggtcctggacggggaacaatatgtgtgacgaggactcaaagaggaacaattcagaag
tag

DBGET integrated database retrieval system