KEGG   Mus musculus (mouse): 233186Help
Entry
233186            CDS       T01002                                 

Gene name
Siglecf, Siglec5, mSiglec-F
Definition
(RefSeq) sialic acid binding Ig-like lectin F
  KO
K06549  sialic acid binding Ig-like lectin 5/14
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    233186 (Siglecf)
   04091 Lectins [BR:mmu04091]
    233186 (Siglecf)
CD molecules [BR:mmu04090]
 Proteins
  233186 (Siglecf)
Lectins [BR:mmu04091]
 I-type lectins (Siglecs)
  233186 (Siglecf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 Ig_2 I-set V-set ig C2-set_2 Ig_5
Motif
Other DBs
NCBI-GeneID: 233186
NCBI-ProteinID: NP_663556
MGI: 2681107
Ensembl: ENSMUSG00000039013
Vega: OTTMUSG00000031683
UniProt: Q920G3
Position
7; 7 B3
AA seq 569 aa AA seqDB search
MRWAWLLPLLWAGCLATDGYSLSVTGSVTVQEGLCVFVACQVQYPNSKGPVFGYWFREGA
NIFSGSPVATNDPQRSVLKEAQGRFYLMGKENSHNCSLDIRDAQKIDTGTYFFRLDGSVK
YSFQKSMLSVLVIALTEVPNIQVTSTLVSGNSTKLLCSVPWACEQGTPPIFSWMSSALTS
LGHRTTLSSELNLTPRPQDNGTNLTCQVNLPGTGVTVERTQQLSVIYAPQKMTIRVSWGD
DTGTKVLQSGASLQIQEGESLSLVCMADSNPPAVLSWERPTQKPFQLSTPAELQLPRAEL
EDQGKYICQAQNSQGAQTASVSLSIRSLLQLLGPSCSFEGQGLHCSCSSRAWPAPSLRWR
LGEGVLEGNSSNGSFTVKSSSAGQWANSSLILSMEFSSNHRLSCEAWSDNRVQRATILLV
SGPKVSQAGKSETSRGTVLGAIWGAGLMALLAVCLCLIFFTVKVLRKKSALKVAATKGNH
LAKNPASTINSASITSSNIALGYPIQGHLNEPGSQTQKEQPPLATVPDTQKDEPELHYAS
LSFQGPMPPKPQNTEAMKSVYTEIKIHKC
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgcggtgggcatggctgctgcccctgctgtgggcagggtgcctggctacggacggttat
tcgctctcagtgactggttcagtgacagtgcaggagggcctgtgcgtctttgtagcctgc
caagtccagtaccccaattccaaaggtcctgtctttggctactggttccgggagggggcc
aatatattcagcggctctccagtggctacaaatgacccacagcgatcagtactgaaggaa
gctcaaggtcgattctatctcatggggaaggaaaatagtcataattgctccctggacatc
agagatgcacagaaaatcgacacagggacgtacttcttcagattggatggttctgtgaaa
tacagttttcagaagtcaatgctctctgtgcttgtgatagctctgactgaggtccctaac
atccaagtcacatctaccctggtgtctggcaattctaccaaactgctctgttctgtgccc
tgggcctgtgagcaggggacaccccccatcttttcctggatgtcatctgccctcacttcc
ctgggccacaggaccaccctctcctcagagctgaacctcacacccaggcctcaggacaat
ggcaccaacctcacctgccaggtgaacttacctggcactggtgttactgtggagaggact
caacagctcagtgtcatctatgctccacagaagatgaccatcagggtgtcctggggagat
gacacaggaactaaagtcctgcagagtggagcatctctgcagatccaagagggtgagtcc
ctgagcctggtctgtatggctgacagcaatccccctgccgtgctgagttgggagcgcccg
acccaaaagcccttccagctctctacccccgcggaactgcaactgccacgggcggagttg
gaggaccagggaaaatacatctgccaagctcagaacagtcagggtgctcagacagcctct
gtgagcctcagcataaggagccttctacagctgctgggaccctcctgctccttcgagggt
caaggtctgcactgcagctgctcctccagagcctggcctgccccctccctgcgctggcgg
ctgggggagggggtgctggaggggaacagcagcaatggctccttcacggttaagtccagc
tccgcaggacagtgggccaacagctccctgatcctcagcatggaattcagctctaaccac
agactcagctgtgaagcttggagtgacaatagagttcagagagccactatcttgctggtg
tcaggcccaaaggtctcacaggcaggcaaatcagaaaccagtagaggaacggtcctgggg
gccatctggggagctggtcttatggccttgcttgctgtctgcctctgcctcatctttttc
acagtgaaggtcctcaggaagaaatcagccctgaaagtagcagctacgaaaggcaaccat
cttgccaagaaccctgcctccaccataaatagtgcaagcataacttcatccaacattgcg
ttgggatacccaatccagggtcatctgaatgaaccagggtcacagacccagaaagaacag
ccaccccttgccacagtcccagacacccaaaaggatgagcctgaactccactatgcctcc
ctctccttccaaggcccgatgcccccgaagcctcagaacacggaggctatgaaatctgta
tacacagagatcaagatccacaagtgctga

DBGET integrated database retrieval system