KEGG   Mus musculus (mouse): 233315
Entry
233315            CDS       T01002                                 

Gene name
Mtmr10, BB128963, C79734
Definition
(RefSeq) myotubularin related protein 10
  KO
K18085  myotubularin-related protein 10/11/12
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    233315 (Mtmr10)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    233315 (Mtmr10)
SSDB
Motif
Pfam: Myotub-related 3-PAP
Other DBs
NCBI-GeneID: 233315
NCBI-ProteinID: NP_766330
MGI: 2142292
Ensembl: ENSMUSG00000030522
Vega: OTTMUSG00000037228
UniProt: Q7TPM9
Position
7; 7 C
AA seq 771 aa
MFSLKPPRPSFRSYLLPPAQTDDKISSEPKIKKLEPVLLPGEIVVNEVNFVRKCIATDTS
QYDLWGKLICSNFKISFITDDPMPLQKFHYRNLLLGEHDVPLTCIEQIVTVNDHKRKQKV
LGPNQKLKFNPTELIIYCKDFRIVRFRFDESGPESAKKVCLAIAHYSQPTDLQLLFAFEY
VGKKYHNSANKVNGVSSGGGGVWSGAGSTGSQRTPLFETYSDWDRETKRTGASGWRVCSI
NEGYMISTCLPEYFVVPSSLADQDLKIFSHSFVGRRMPFWCWSHSNGSALVRMALIKDAL
QQRKIDQRICNAITKSHPQRSDVYKSDLDKALPNIQEIQAAFVKLKQLCVNEPFEETEEK
WLSSLESTRWLEYVRAFLKHSAELVYILESQRLSVVLQEEEGRDLSCLVASLIQVMMDPY
FRTITGFQSLIQKEWVMAGYQFLDRCNHLKRSEKESPLFLLFLDTTWQLLEQYPAAFEFS
ETYLAVLCDSTRISLFGTFLFNSPHQRVKQSTEFAISKNIQLGDEKGLKFPSVWDWALQF
TAKDRTLFHNPFYIGKSTPCVQNGSRKSFKRTKKSYSSTLRGMPSCLKNGIITDQDLLPR
RNSLVLKLKPDPPQHTDSQHSGAEQYFKEWFSRPANLHGIILPRLSGTHIKLWKLCYFRW
VPEAQINLGGSIMAFHKLSLLADEVDMLSRMLRQHRSGPLEACYAELDQSRMYFRATGPH
DTLGTPEFLSSSFPFSPVGNLCRRSILGTPLSKFLSGAKIWLSTETLANED
NT seq 2316 nt   +upstreamnt  +downstreamnt
atgttctctctcaagccgcccagacccagcttcaggtcctacctcctgccgccggcccag
actgacgataagatcagttccgaaccgaagattaaaaagctggagccggtccttttgcca
ggagaaattgttgtaaatgaagtcaattttgtgagaaaatgcatcgcaacagacacgagc
cagtatgatttgtggggcaagttgatatgcagtaacttcaaaatttcctttatcacagat
gacccaatgccattacagaaattccattatagaaaccttcttcttggagaacatgatgtc
cctttgacatgtattgaacagattgtcacagtgaatgaccacaagaggaaacagaaagtc
ctaggtcccaaccagaagctgaaattcaatccaacagaattaattatttattgtaaagat
ttccgaattgtcaggtttcgctttgatgagtccggtcctgaaagtgccaagaaggtatgc
cttgcaatagctcattattcccagccaacagacctccagctactctttgcatttgaatat
gttgggaaaaaataccacaattcagccaacaaggttaatggagtatcctcaggaggtgga
ggagtatggagtggagctggcagtaccggcagccagaggacgccactgttcgaaacttac
tcagattgggacagagagaccaagaggacaggcgcttctgggtggagagtttgttctatc
aacgagggttacatgatatctacttgccttccagaatactttgttgtgccaagttcacta
gcagaccaagacctgaagatcttttcccattcctttgttggaagaagaatgccattctgg
tgctggagccactctaacggcagtgctcttgtgcggatggccctcatcaaagacgcgctg
caacagaggaagattgaccagaggatctgcaatgccataactaaaagtcatccacagaga
agtgatgtttacaagtcagatttggataaggctttgcccaacatccaagaaatacaagcg
gcatttgtaaaacttaagcaactgtgtgtaaatgagccttttgaagaaactgaagagaaa
tggttgtcttcactggaaagtacccggtggttagagtacgtcagggctttccttaaacac
tcagcagaacttgtgtacattcttgaaagccagcgtctctctgtagtcctgcaagaggag
gaaggcagagacttgagttgtctggtggcttctctcattcaagtgatgatggatccatac
ttcaggacaattactggatttcagagtctgatacagaaggagtgggtcatggcgggctat
cagttcctagacagatgcaaccacttgaagaggtcagagaaagagtctcctttattcttg
ctgttcttggataccacgtggcagctgctcgagcagtacccagctgccttcgagttctcc
gagacgtacttagcagtgctgtgtgacagcacccggatctcgctgttcggcaccttcctc
ttcaactctcctcatcagcgggtgaagcagagcacagagtttgccatcagcaaaaacatt
cagctgggtgatgaaaagggcttgaaattcccctcagtgtgggactgggctcttcagttc
actgcgaaggatcgcactcttttccacaaccccttctacattggcaagagcacaccttgt
gttcagaacggctccaggaagtcttttaagcgcacgaagaagagctacagctccacactg
agaggaatgccctcatgcttgaagaatgggatcatcactgaccaagacctgctgcctcgg
agaaactccctcgtcctgaagctgaagccggacccgcctcagcacaccgacagccagcac
agtggagccgagcagtattttaaagagtggttctccagaccagccaacctacacggcatt
atcctgccacgtctctccggaacacacataaaattgtggaaactgtgctacttccgttgg
gtccctgaggcccagatcaacctcgggggctccatcatggccttccacaagctctctctc
ctggctgatgaggtggacatgctgagcaggatgctgaggcagcaccgcagcggccccttg
gaagcctgctatgcagagctggaccagagcaggatgtacttccgggccacggggccacat
gacacgctggggacaccagagttcctctcctcttcatttccattttctcctgtaggaaat
ctgtgtagacgaagcattttaggaacgccattaagcaaatttttaagtggggccaaaata
tggttatctactgagacactagcaaatgaagactaa

DBGET integrated database retrieval system