KEGG   Mus musculus (house mouse): 233489
Entry
233489            CDS       T01002                                 
Symbol
Picalm, CALM, CLTH, PAP180, fit-1, fit1, mKIAA4114
Name
(RefSeq) phosphatidylinositol binding clathrin assembly protein
  KO
K20044  phosphatidylinositol-binding clathrin assembly protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    233489 (Picalm)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    233489 (Picalm)
SSDB
Motif
Pfam: ANTH ENTH
Other DBs
NCBI-GeneID: 233489
NCBI-ProteinID: NP_666306
MGI: 2385902
Ensembl: ENSMUSG00000039361
Position
7:89778711..89858655
AA seq 660 aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLA
DSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDM
STFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKF
LTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKKIKDSTAASRAT
TLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHAMSAAPQGASTWGD
PFSATLDAVEDAIPSLNPFLTKSSGDVHLPIASDVSTFTTRTPTHEMFVGFSPSPVAQPH
SSAGLNVDFESVFGNKSTNVAVDSGGFDELGGLLKPTVASQNQSLPVAKLPPNKLVSDDL
DSSLANLVGNLGIGNGTTKNDVSWSQPGEKKLTGGSNWQPKVAPTTAWSAATMNGMHFPQ
YAPPVMAYPATTPTGMIGYGIPPQMGSVPVMTQPTLIYSQPVMRPPNPFGPVSGAQIQFM
NT seq 1983 nt   +upstreamnt  +downstreamnt
atgtctggccagagcctgacggaccgaatcaccgcggcccagcacagtgtcactggctcc
gcggtatctaagacagtatgcaaggccacgacccacgagatcatgggccccaagaaaaag
cacctggactacttaattcagtgtacaaatgagatgaatgtgaacatcccacagttggcg
gacagtttgtttgaaagaactactaacagtagttgggtggtggtcttcaaatcactcatt
acaactcatcatttgatggtgtatggaaatgagcgtttcattcagtatttggcttcaaga
aacacattgtttaacttaagcaattttttggataaaagtggattgcaaggatatgatatg
tctacatttattagacggtatagtagatacttaaatgaaaaagcagtttcatacagacaa
gttgcattcgatttcacaaaagtgaagagaggagctgatggagttatgagaacaatgaac
acagaaaaactcttaaaaactgtaccaattatccaaaatcaaatggatgcacttcttgat
tttaatgttaatagtaatgaacttacaaatggggtaataaatgctgccttcatgctcctc
ttcaaagatgccattagactatttgcagcatacaatgaaggaattattaatttattggaa
aaatattttgatatgaaaaagaaccagtgcaaagaaggtcttgacatctataagaagttt
ctgactaggatgacaagaatctcagagtttctgaaagttgcagagcaagttggaattgac
agaggagatattccagatctttcacaggcccccagcagtcttcttgatgctttagaacaa
catttagcttccttggaaggaaagaaaatcaaagattccacagctgcaagcagggctaca
acactttccaatgcagtctcttctttggcaagcactggcctatctctgaccaaagtggat
gaaagggaaaaacaggcagcattagaggaagaacaggctcgtttaaaagcattaaaggaa
cagcgtctaaaagaacttgcaaagaaaccgcatacctctctaacaactgcagcctctccg
gtgtccacctcagcagggggaataatgactgcaccagccattgacatattttctacccct
agttcttctaacagcacatctaagctgccaaatgacctgcttgacttgcagcagccaacc
tttcacccgtctgtccacgccatgtcggctgctcctcagggagcgagtacatggggagat
cctttctctgctactctagatgctgttgaggatgccattccaagcttaaaccctttcctc
acaaaaagtagtggtgatgttcacctgcccattgcttcagatgtatccacttttactact
aggacacctactcatgagatgtttgttggattcagtccttctccagttgcacagccacat
tcttcagctggccttaatgttgactttgaatctgtgtttggaaataaatctacgaatgtt
gctgtagattctggtggctttgatgaactaggtggacttctcaaaccaacagtggcctcc
cagaaccagagtcttcctgttgccaaacttccgcctaacaaattagtgtctgacgacttg
gattcatctttagccaaccttgtgggcaatcttggcattggaaatggaaccactaagaat
gatgtaagttggagtcaaccaggtgaaaagaagttaactggaggatctaactggcaacca
aaggttgcaccaacaactgcctggagcgctgcaacaatgaatggcatgcattttccacaa
tacgcgccccctgtaatggcctatcctgctactacaccaacgggcatgataggatatgga
attcctcctcagatgggaagtgtacctgtaatgacacaaccaaccttaatatacagccag
cctgtcatgagaccaccaaacccctttggccctgtatcaggagcacagatacagtttatg
taa

DBGET integrated database retrieval system