KEGG   Mus musculus (mouse): 233571
Entry
233571            CDS       T01002                                 

Gene name
P2ry6, 2010204J23Rik, P2Y, P2Y6
Definition
(RefSeq) pyrimidinergic receptor P2Y, G-protein coupled, 6
  KO
K04272  P2Y purinoceptor 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    233571 (P2ry6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    233571 (P2ry6)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    233571 (P2ry6)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv PUCC FAM163
Other DBs
NCBI-GeneID: 233571
NCBI-ProteinID: NP_898991
MGI: 2673874
Ensembl: ENSMUSG00000048779
Vega: OTTMUSG00000060006
UniProt: Q9ERK9 Q3UQ86
Position
7; 7 E2
AA seq 328 aa
MEQDNGTIQAPGLPPTTCVYREDFKRLLLTPVYSVVLVVGLPLNICVIAQICASRRTLTR
SAVYTLNLALADLMYACSLPLLIYNYARGDHWPFGDLACRFVRFLFYANLHGSILFLTCI
SFQRYLGICHPLASWHKRGGRRAAWVVCGVVWLAVTAQCLPTAVFAATGIQRNRTVCYDL
SPPILSTRYLPYGMALTVIGFLLPFIALLACYCRMARRLCRQDGPAGPVAQERRSKAARM
AVVVAAVFAISFLPFHITKTAYLAVRSTPGVSCPVLETFAAAYKGTRPFASVNSVLDPIL
FYFTQQKFRRQPHDLLQRLTAKWQRQRV
NT seq 987 nt   +upstreamnt  +downstreamnt
atggagcaggacaatggcaccatccaggctccaggcttgccgcccaccacctgcgtctac
cgtgaggatttcaagcgactgctgctaaccccggtatactcggtggtgctggtggtcggc
ctgccactgaacatctgcgtcattgcccagatctgcgcatcccgccggaccctgacccgt
tccgctgtgtacaccctgaacctggcactggcggacctgatgtatgcctgttcactaccc
ctacttatctataactacgccagaggggaccactggcccttcggagacctcgcctgccgc
tttgtacgcttcctcttctatgccaatctacatggcagcatcctgttcctcacctgcatt
agcttccagcgctacctgggcatctgccaccccctggcttcctggcacaagcgtggaggt
cgccgtgctgcttgggtagtgtgtggagtcgtgtggctggctgtgacagcccagtgcctg
cccacggcagtctttgctgccacaggcatccagcgcaaccgcactgtgtgctacgacctg
agcccacccatcctgtctactcgctacctgccctatggtatggccctcacggtcatcggc
ttcttgctgcccttcatagccttactggcttgttattgtcgcatggcccgccgcctgtgt
cgccaggatggcccagcaggtcctgtggcccaagagcggcgcagcaaggcggctcgtatg
gctgtggtggtggcagctgtctttgccatcagcttcctgcctttccacatcaccaagaca
gcctacttggctgtgcgctccacgcccggtgtctcttgccctgtgctggagaccttcgct
gctgcctacaaaggcactcggcccttcgccagtgtcaacagtgttctggaccccattctc
ttctacttcacacaacagaagttccggcggcaaccccacgatctcttacagaggctcaca
gccaagtggcagaggcagagagtctga

DBGET integrated database retrieval system