KEGG   Mus musculus (house mouse): 233575
Entry
233575            CDS       T01002                                 
Symbol
Pgap2, 1810006G21Rik, Frag1, clpex
Name
(RefSeq) post-GPI attachment to proteins 2
  KO
K23552  post-GPI attachment to proteins factor 2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    233575 (Pgap2)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Post-GPI attachment to proteins factors (PGAP)
    233575 (Pgap2)
SSDB
Motif
Pfam: Frag1 YtpI
Other DBs
NCBI-GeneID: 233575
NCBI-ProteinID: NP_001278287
MGI: 2385286
Ensembl: ENSMUSG00000030990
UniProt: Q3TQR0 Q3U6W8
Position
7:101859153..101887771
AA seq 250 aa
MYQVPLTLDRDGTLVRLRFTMVALITVCCPLVAFFFCILWSLLFHFKETTSTHCGVPNYL
PSVSSAIGGEVPQRYVWRFCIGLHSAPRFLTAFAYWNHYLSCASPCPGYRLLCRINFSLN
VVENLALLVLTYVSSSEDFTIHENAFIVFIAASLGYMLLTCILWRLTKKHTDRKSYSWKQ
RLFVINFISFFSALAVYFRHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDFGNKELL
ITSQPEEKRF
NT seq 753 nt   +upstreamnt  +downstreamnt
atgtaccaggtcccactgacattggaccgggatgggaccctagtccggctccgcttcact
atggtggccctgatcactgtctgctgtccacttgtcgccttcttcttctgcatcctgtgg
tccctgctctttcacttcaaggagacaacatctacacactgtggggtgcccaattacctg
ccatcagtgagctccgccattggtggggaggtcccccaacgctacgtgtggcgtttctgc
attggcctgcactcggcaccccgcttcttgacagccttcgcctattggaaccactacctc
agctgtgcgtctccatgtccgggttaccgccttctctgccgcattaacttcagtctcaat
gtggtggagaacctcgcgctgctcgtgctcacctacgtctcctcctccgaggacttcacc
atccacgaaaatgctttcattgtgtttatcgcggcatccctcggttacatgctcctcacc
tgcattctctggcggctgaccaagaagcacacagatcgcaagtcctacagctggaaacag
cggctcttcgtcatcaacttcatctccttcttctcggcgctggctgtctacttccggcac
aacatgtattgtgaggctggagtgtataccatctttgccatcctggagtacactgttgtc
ctaaccaacatggcgttccacatgacagcctggtgggacttcgggaacaaagagctgcta
ataacctctcagcctgaggaaaagagattctaa

DBGET integrated database retrieval system