KEGG   Mus musculus (house mouse): 233651
Entry
233651            CDS       T01002                                 
Symbol
Dchs1, 3110041P15Rik, C130033F22Rik, CDH25, FIB1, Gm165, PCDH16
Name
(RefSeq) dachsous cadherin related 1
  KO
K16507  protocadherin-16/23
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04392 Hippo signaling pathway - multiple species
    233651 (Dchs1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    233651 (Dchs1)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Cadherin related
   233651 (Dchs1)
SSDB
Motif
Pfam: Cadherin Cadherin_3 Cadherin_4
Other DBs
NCBI-GeneID: 233651
NCBI-ProteinID: NP_001156415
MGI: 2685011
Ensembl: ENSMUSG00000036862
UniProt: E9PVD3
Position
7:complement(105402196..105437562)
AA seq 3291 aa
MQKELSVALSCPGMKSLRTLLPLLVLLGATVPGSWGQAGSLDLQIDEEQPAGTLIGDISA
GLPPGTAPPPMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDRERRDRYRFTAVTPDGAT
VEVTVRVADINDHAPAFPQARAALQIPEHTALGTRYPLEPARDADAGRLGTQGYALSGDG
AGETFRLETRPGPGGAPVPELVIAGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLL
DINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGANGAVTYEINRRQSEGDGPFS
IDAHTGFLRLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIF
LSADGSPRVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCV
ARRLDREERDVYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVA
LPGSFVVRVTARDPDQGTNGQITYSLAPGTHTHWFSIDPTSGIITTAATLDYELEPQPQL
IVVATDGGLPPLVSSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDAD
SGPFGLLSYSLGAGLGASGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAIDGGGLK
SMVYVKVFVADENDNPPQFYPREYAASLSAQSTPGTAVLRVHAHDPDQGPHGRLSYHILA
GNSPPLFALDAHSGLLTVAWPLGRRANSVVQLEIGAQDGGGLQAEPIARVNISIVPGTPT
PPIFEQLQYVFSVPEDVAPGTSVGIIQAHNPPGRLGPVTLTLSGGDPRGLFSLDSPSGLL
KTLRPLDRELLGPVLELEVRAGSGTPPVFAVARIRVLLDDVNDNSPAFPAPEDTVLLPQN
TAPGTPIYTLRALDPDSGANSRITFNLLAGGDGLFTVDPTTGHVRLMGPLGPPGGPAHEL
EVEARDGGSPPRTSHFRLRVVIQDLGIHGLAPRFDSPTYRVDLPSGTTTGTQILQVQAQA
PDGSPVTYHLAADGASSPFGLESQSGWLWVRTALDRESQELYTLKVMAVSGSKAELGQQT
GTATVRVIILNQNDHSPRLSEEPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQ
LSEDSKAFRIHPQTGEVTTLQTLDREQQSSFQLLVQVQDGGSPPRSATGTVHVAVLDLND
NSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSL
HPHTGELHTAASLVRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSTRVVESPDLIEA
DSAATVPVVLTVTAAEGLRPGSLLGSVAPQEPASVGVLTYTLVGGADPEGTFALDSASGR
LYLARPLDFEAGPAWRALTVRAEGPGGAGARLLRVQVRVQDENEHAPTFARDPLALALPE
NPDPGATLYTFRASDADGPGPNSEVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTP
ALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRVRLPEDQPPGPAALHV
VARDPDLGEAARVSYRLAAGGDGHFRLHATTGALSVVRPLDREQRAEHVLTVVALDHGSP
PRSSTQLLTVSVVDVNDEAPAFPQQEYNVILRENSPPGTSLLTLKATDPDLGANGQVTYG
GVSGESFSLDPNTGVLTTLRALDREEQEEIYLTVYARDRGLPPLLTHITVRVTVEDENDH
TPTFGNTHLSLEVPEGQDPQTLTTLRASDPDGGLNGQLQYRILDGDSSGAFALDLTSGEF
GTMRPLDREVEPAFQLQIEARDGGQPALSATLLVTVTVLDANDHAPVFPVPSYSVEVPED
APVGTLLLQLQAHDPDDGDNGRVMYYLGAGTAGAFLLEPTSGELSTATALDREHCASYAF
SVTAVDGAAAGPLSTTVPITITVRDVNDHAPAFPTSPLRLRLPRPGPSLNKPTLALATLR
AEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPQDRVLFIVATDLGRPA
RSATGVVVVGIQGEPERGPRFPRTSSEAVLRENAPPGTPVISPKAVHSGGSNGPITYSIL
SGNERGIFSIQPSTGAITVRSAEGLDFETSPRLRLVLQAESGGAFAFSVLTLTLQDANDN
APRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPATG
TITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQPWELRVSE
DALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDPFSIGRYGGRVSLTGPLDFEQCDHYHL
QLLAHDGPHEGHANLTVLVEDVNDNVPTFSQSLYQVMMLEHTPPGSAILSVSATDRDSGA
NGHISYHLASPAEGFRVDPNNGTLFTTVGAMALGHEGPGVVDVVLEARDHGAPGRTAQAT
VHVQLKDQNDHAPSFTLPHYRVAVSEDLPPGSTLLTLEATDADGSRTHATVDYSIISGNR
GRVFQLEPRLAEVGDGVGPGPQALGCLVLLEPLDFESLTQYNLTVAAADRGQPPRSSAVP
VTVTVLDVNDNPPVFTRASYRVTVPEDMPVGAELLHVEASDADPGPHGLVHFTLSSGDPL
GLFELDENSGALRLSRPLDCETQAQHQLVVQAADPAGTHFSLVPVTVEVQDVNDHGPAFP
LSLLSTSLAENQPPGTLVTTLHAIDGDAGTFGRLRYSLLEAVPGPEGREAFSLNSSTGEL
RARVPFDYEHTGSFRLLVGAADAGNLSASVTVSVLITGEDEYDPVFLAPSFHFQVPEGAQ
RGHSLGHVQATDEDGGADGLVLYSLATSSPYFGINQTTGALYLRVDSRAPGSGTTTSGGG
GRTRREAPRELRLEVVARGPLPGSRSATVPVTVDITHTALGLAPDLNLLLVGAVAASLGV
VVVLALAALVLGLVRARSRKAEAAPGPMSQTAPIASSSLQKLGREPPSPPPSEHLYHQTL
PSYGGPGAGGPYPRGGSLDPSHSSGRGSAEAAEDDEIRMINEFPRVASVASSLAARGPDS
GIQQDADGLSDTSCEPPAPDTWYKGRKAGLLLPGAGATLYREEGPPATATAFLGGCGLSP
APAGDYGFPADGKPCVAGALTAIVAGEEELRGSYNWDYLLSWCPQFQPLASVFTEIARLK
DEARPCPPAPRIDPPPLITAVAHPGAKSVPPKPASTAVARAIFPPASHRSPISHEGSLSS
AAMSPSFSPSLSPLAARSPVVSPFGVAQGPSASALSTESGLEPPDDTELRI
NT seq 9876 nt   +upstreamnt  +downstreamnt
atgcagaaggagctgagtgtcgcactttcctgccctggcatgaagagcctcaggactcta
ttaccattgctggtgctgttaggggctacagtgccaggaagctggggtcaggctgggagc
ctggacctacagatcgacgaggaacaaccagcaggcacgctgattggagacatcagtgca
gggcttccaccaggcacagcgcctcctcccatgtacttcatctctgcccaggaaggcagt
ggcgtaggcacagaccttgctattgatgagcacagtggagtggtccgtacagctcgggtc
ctagaccgtgagcggagagaccgttaccgcttcactgcagtcactcctgatggggccacc
gtggaagttacagtgagagtagctgatatcaatgaccacgcaccagctttccctcaggct
cgggcagccctgcagatacctgagcatacagctcttggtacacgttacccactggagcct
gctcgtgatgcagatgccggccgcctaggaacccaagggtatgcgctatctggtgatggg
gctggagagacctttcggctggagacacgtcctggtcctggtggagctccagtacctgag
ctggtgattgccggagaactggaccgggagaaccgctcacactacatgttgcagctcgaa
gcctacgatggtggctcacctccgcggagagcacaggccctgctagatgtgacacttctg
gacatcaatgaccatgccccagctttcaatcaaagccgataccatgctgtggtatctgag
agtctggcccctggaagtcctgttttgcaggtgtttgcatctgatgctgatgctggtgcc
aacggagctgtgacttatgagatcaacaggagacagagtgaaggtgatggacccttctcc
attgatgcacacacagggtttctgaggctggagcgcccactggactttgaacaaaggcga
gttcatgaactggtggtacaggcacgggatggtggggctcacccagagctgggttcagct
tttgtgacagtgcatgtgcgagatgcaaatgacaatcagccgtccatgactgtcatcttc
ctgagtgctgatggctccccccgagtgtctgaggctgccccacctggacagcttgttgct
cgaatctctgtgtcagatccagatgatggtgacttcgcccacgtcaatgtgtccctggaa
ggtggagagggccactttgctctgagcacccaagacagtgtcatctatctggtgtgtgtg
gctcgaaggctggatcgggaggagagagatgtctataacttgcgagtcacagccacggac
tcaggctcacccccacttagggccgaagctgcttttgtgctacatgtcactgatgtcaat
gacaacgcacctgcttttgaccgccagctctaccgacctgagcctctgcctgaagttgca
ttgcctggcagcttcgtggtacgggtgactgcccgggatcctgaccaaggcaccaatggt
cagatcacctacagcctggctcctggcactcacactcactggttctccattgatcccact
tcaggcatcatcaccacagctgccacactggactatgaactagagcctcagccacagctt
attgtggtggccacagatgggggcctgcctcctttagtctcctcggccacagttagtgtg
gccttacaagacgtgaatgacaatgagccccagttccagaggactttctacaatgcctcg
ctgcctgaaggtacccagcctggaacctgtttcctgcaggtaacagccacagatgctgac
agtggcccatttggcctcctctcctattccttgggtgctgggcttggagcttctggatcc
cccccattccgcattgatgcccacagtggtgatgtgtgtaccacccggaccctggaccgt
gatcagggaccttcaagctttgacttcacggtgacagctatcgatgggggaggcctcaag
tccatggtgtacgtgaaggtatttgtggcagatgagaatgacaacccacctcagttttat
ccacgggagtatgctgccagtctgagtgctcagagtacaccaggcacagctgtgctgagg
gtgcatgcccatgaccctgaccagggaccccatgggcgactttcctaccatatcctggct
ggcaacagtcccccactctttgcattggatgcacactcagggctgttgacagtagcctgg
cccttaggcagacgggctaattctgtggtgcagctggagatcggggctcaggatggaggt
ggtctacaagcagaacccattgcccgagtcaacatcagcattgtgcctgggacccccaca
ccacctatatttgagcaactacagtatgttttttcagtgccagaagatgtggcacccggc
accagtgtgggcataatccaggcacacaacccaccaggtcgcttagggcctgtgaccctc
accctatcaggtggggacccccgagggctcttctccctagattcaccctcagggctatta
aaaacacttcgccctctggaccgggagctcctgggacctgtcctagagctagaagttcga
gcaggcagtggaaccccaccagtgtttgctgtggctcggatccgcgtgctgctggatgat
gtgaatgataattctcctgccttccctgcacctgaagacactgtactgttgccacaaaac
actgctccagggactcccatctatacactgcgcgctctagaccctgactcaggagctaac
agtagaatcacctttaatctacttgctgggggtgatggattgttcactgtggatcccacc
acaggccacgtccggctcatgggacctctggggcctccagggggaccagcccatgagttg
gaggtggaggcccgggatggaggctccccaccacgcaccagccatttccgacttcgtgtg
gtgatacaggatttgggaatccatgggctggctccacgatttgatagccctacctaccgt
gtggacttaccctcgggcactaccaccggaactcagatcttgcaagtgcaggcccaggca
ccagatgggagccctgtcacttaccatcttgcagcagatggtgccagtagcccctttggc
ctggagtcacagagtgggtggctgtgggtacggacagcactagaccgtgagtcccaggag
ttatacacattgaaggtgatggctgtatccggttccaaagctgaattggggcaacagaca
ggcacagccacagtgagggtcattatcctcaaccaaaatgaccacagtccccgcttgtct
gaagagcccacctttctggctgtagcagagaatcaacccccagggaccagtgtaggccga
gtctttgccactgacagagactcaggtcctaatggacgtctgacctacagccttcaacag
ctttcagaagacagcaaggccttccgcatccacccccagactggagaagtgactacactc
caaaccctggaccgagagcagcagagcagtttccagctcctggtgcaagtgcaggatggg
ggtagtccacctcgcagtgccacaggcactgtgcatgtcgctgtgctcgatcttaatgac
aacagtcccaccttcctgcaggcttcaggggctgctggtgggggcctccctatacaggta
ccagatcgagtgcctccaggaacactggtgacaactctacaggccaaagatccagatgag
ggggagaatggaaccatcctatacaccctaactggtcctggctctgagctcttctctctg
catcctcacaccggggagctgcacacagcagcatccctggttagagctgagcggcctcac
tatgtactaactctaagtgctcacgaccagggcagcccccctcgaagtgccagcctccaa
ctgctcgtgcaggtacttccctcgactcgggtggtggagtcaccagatctcatagaagct
gactcagcggcaacagtgcctgtagtacttacggtgacagcagctgagggccttcgacct
ggatccctgttgggttcggtggccccgcaggagccagctagtgtgggcgtactcacctat
actctggttggtggcgcggaccccgagggcaccttcgcgctggactcagcctccggtcgc
ctgtacttggcgcgtcccttggacttcgaggctgggccagcctggcgcgcgctcaccgtg
cgcgccgaggggccgggaggcgcaggcgcgcggctgttgagagtgcaggtgcgtgtgcag
gacgagaacgagcacgcgccaacttttgcgcgcgaccccctggcactggcgctacctgag
aaccccgaccccggtgccacgctatacactttccgcgcatcagacgccgatggcccaggt
cccaacagtgaggtgcgataccgcctgctgaggcaggagcccccggtgcccgccctgcgc
ttggacgcgcgcaccggggcgctcagcgctcctcgtggtctggatcgagagaccacacct
gcgctgttactgctcgtggaagccaccgaccggccagccaatgccagccgccgcagggca
gcgcgcgtttcagcgcgcgtctttgtcacagatgaaaatgacaacgccccggtcttcgcc
tccccatcacgggtgcgcctcccagaggatcagccccctgggcccgcagcactgcacgtg
gtagctcgggatccagacctgggggaggctgcccgcgtgtcctatcgccttgcggctgga
ggggacggccacttccggctacacgcgaccactggagcgctgtccgtggtgcggcctttg
gaccgtgaacagcgagctgagcatgtactgacagtggtggccttggaccatggctcccct
ccacgttcatccactcagctcctgactgtcagtgttgttgacgtcaacgacgaggcaccg
gctttccctcagcaggagtacaatgtcatccttcgtgagaacagtccccctggcacttct
ctgctcactctgaaggcaactgaccctgaccttggggccaatgggcaagtgacttatggg
ggtgtctctggcgagagcttctctctggacccaaacactggagttctcacgactctgagg
gctctggaccgggaggagcaggaggagatctatttgacagtatatgctcgggataggggc
ttgccacccctgttaacgcacatcacagtgagagtgactgtggaagatgaaaatgaccat
actccaacttttgggaacacccacctctccctggaagtgcctgaaggccaggacccccaa
accctaaccacactaagagcctctgatccagatgggggactcaatggacagctacagtac
cgcatccttgatggggactcttcaggagcctttgcactagatctcacttctggggagttt
ggcaccatgaggccactagaccgggaggtagagccagcattccagctgcagatagaggcc
agagatggaggccagccagccctcagtgccaccttgcttgtgacagtgacagtgctggat
gccaatgaccatgcaccagtctttcctgtgccttcttattctgtggaggtgcctgaggat
gcacctgtagggaccctactgctgcagctacaggctcatgacccagatgatggggacaat
ggccgtgtgatgtactacctgggtgcaggtacagcgggggccttcctgttggagcctacc
tctggggaactgagcacagctacagccttggacagagaacactgtgccagctatgccttt
tctgtgaccgcagtggatggtgcagctgctgggcctctgagcaccacagtaccaatcacc
atcacagtgcgtgacgtcaatgatcatgcacccgctttccccacgagtcctctccgcctc
cgcctaccccgcccaggtcctagcctcaacaaaccaaccctggctctggccacgcttcga
gctgaagatcgagatgctggtgccaatgcctccattctataccggctggcaggcacacca
ccacctggcaccactgtggactcttacactggtgaaattcgtgtggctcgatcccccgtg
gctcttggaccccaggatcgtgtcctcttcattgtagctactgaccttggacgcccagct
cgctccgccactggtgtggtcgttgttggaatacagggagagcctgagcgtggaccccgc
tttcccagaactagtagtgaggctgtgctccgtgaaaatgcaccaccagggactccagtt
atctccccaaaggctgtccattcaggaggttcaaatggaccaattacttatagcattctc
agtgggaatgagagagggatattctccatccaacctagcacaggagccatcacagttcgc
tcagcagagggtcttgactttgaaacaagcccacggctgcggctggtgctacaggcagag
agtggaggagcctttgctttctcagtgctgaccctgacccttcaagatgccaatgacaac
gctccccgtttcctgcggcctcactatgtggctttcctgccagagtcccgacccttggaa
gggcccctgctgcaggtggaagccgatgacctggaccaaggctctggaggacagatttcc
tacagtctggctgcatcccagccagcacggggcttgttccatgtagacccagccacaggc
actatcactaccacagccatcctggaccgggaaatctgggcagaaacacggctggtactg
atggccacagacagaggaagcccagcactggtgggctcagctaccctgacagtgatggtc
atcgataccaatgacaatcgtcccaccatcccccagccctgggagctccgagtatcagaa
gatgcactgttgggctcagagatcgcacaggtgactgggaatgacgtggactctggacca
gtgctatggtatgtgctgagcccatcggggcctcaggatcccttcagtattggccggtat
ggaggacgtgtctccctcacgggccccctggactttgagcagtgtgaccactaccaccta
cagctgctggcacatgatgggcctcatgagggccatgccaacctcacagtgcttgtggaa
gatgtcaatgacaatgtacctaccttctcacaaagcctctaccaggtaatgatgttggag
cacacccctccgggcagcgccattctctccgtctctgccaccgacagagactcgggtgcc
aatggtcacatatcttaccatctggcttcccctgctgagggcttccgtgtcgaccctaac
aatggaactctgttcacaacagtaggagcaatggccttgggtcatgaggggccaggagtg
gtggatgtggtactggaagcccgagaccatggggctccaggccggacagcacaggccaca
gtgcatgtgcagctgaaggaccagaatgaccatgccccaagcttcacattgccacactac
cgtgttgctgtgtctgaagatttgccccctggttccaccctgctcaccctggaggccaca
gatgctgatggaagccgcacccatgctactgtggactacagcatcatcagtggcaatcgg
ggccgagttttccagctggaaccccgtctggctgaggtcggggacggtgttgggccaggt
ccccaagcactgggctgcctagtgttgcttgaacctctagactttgaaagcctgacacag
tacaatttaactgtggctgcagctgatcggggacagccaccccgcagttcagccgtgcca
gtgactgtcactgtgctggatgtcaatgacaacccacccgtctttactcgagcatcctac
cgtgtgacagtacctgaggacatgcctgttggagctgagctattgcatgtggaggcctct
gatgctgaccctggacctcatggtcttgtgcatttcactcttagttcaggtgaccctttg
ggtctctttgagctggatgagaactcgggtgccttgaggctatcccgccctctggactgt
gaaacccaggctcaacaccagcttgtggtgcaggcagctgaccctgctggaacacacttt
tctttggtaccagtgacagttgaggtccaggatgtgaatgaccatggtccggccttccca
ttgagtctgctcagtactagccttgctgagaatcagcctccaggcactcttgtgaccaca
ctacacgcgattgatggggatgctgggacttttggtagactccgatatagcctgttggag
gcagtgccagggcctgagggtcgtgaggcattttccctgaacagctcaacaggggaattg
cgggcacgggtgccttttgactatgagcacacaggaagcttccgtctactagtgggtgct
gccgatgctgggaatctctcagcctctgtcactgtgtcagtactgattactggagaagat
gaatatgaccctgtattcttggctccatctttccatttccaagtgccagaaggtgcccag
cgaggccacagcctgggtcacgtgcaggccacagatgaggatggaggtgccgatggtctg
gtgctctactcgctggctacctcttccccctattttggtatcaaccagacaacaggtgct
ttgtacttgcgagtggacagtcgcgcaccaggaagtggaacaaccacctctgggggtggg
ggccggacccgacgtgaagcacctcgggagttaaggctggaggtagtagcaagagggcct
ctgcctggatcccggagtgccacagtacctgtgactgtggatattacccacactgctcta
ggcctggcacctgacctcaacttgctattggttggggctgtggcagcctccttgggagtt
gtggtggtgcttgccctggcagctctggtcctgggccttgttcgggcgcgaagccgcaag
gctgaggcagcccctggcccgatgtcacagacagcgccgatagccagtagctctttacag
aaactgggtcgggaaccccccagtccaccaccctctgaacatctgtatcatcagactctt
cccagctacggtggcccaggagctggaggtccctaccctcgtggcggctccctggaccct
tcacattcaagtggcagaggctcagcagaggctgcagaggatgacgagatccgcatgatc
aacgagtttccccgagtggccagtgtagcctcctccctggctgctcgaggccctgactct
ggcatccagcaggatgcggatggattgagtgacacgtcttgtgagcctcctgcccctgac
acctggtacaagggcagaaaggcagggttgctgctgccaggcgcaggagccactctgtac
cgagaggaggggcctccagccactgctacagccttcctggggggctgtggcctgagccct
gcacccgctggggactatggcttcccagcagacgggaagccgtgtgtagctggagcactg
acggccattgtggctggtgaggaagagctccgtggcagctataactgggactacctgttg
agctggtgccctcagttccagcctctggccagtgtcttcacagagattgctcggctcaag
gatgaagctcgtccgtgtcctccagctccccgtattgacccaccacccctcatcactgct
gtggcacacccaggagccaagtctgttcccccaaagcctgcaagcacagctgtagcccgg
gccatcttcccaccagcctctcaccgctcccctatcagccatgaaggctccctctcctca
gctgccatgtcccccagcttctcaccctcactgtctcctttggctgctcgctctcccgtt
gtctcaccattcggggtagcccagggcccctcagcttcagcactcagtacagagtctggc
ctggagcctccggatgacacagagctgcgcatctag

DBGET integrated database retrieval system