KEGG   Mus musculus (mouse): 233670Help
Entry
233670            CDS       T01002                                 

Gene name
Olfr6, M50, MOR103-16
Definition
(RefSeq) olfactory receptor 6
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    233670 (Olfr6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    233670 (Olfr6)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    233670 (Olfr6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 233670
NCBI-ProteinID: NP_996780
MGI: 104713
Ensembl: ENSMUSG00000036647
Vega: OTTMUSG00000059728
UniProt: P34986 A0A0R4J0M0
Position
7 E3; 7 56.1 cM
AA seq 316 aa AA seqDB search
MENITNISEFILMGFPTAPWLQILLFSIFFITYVFVLLENLVIILTVWVTGSLHKPMYYF
LSTMSFLEAWYISVTVPKMLAGFLFHPNTISFLGCMTQLYFFMSLACTECVLLAAMAYDR
YVAICWPLRYPVMMTTGFCVQLTISSWVSGFTISMAKVYFLSRVAFCGNNVLNHFFCDVS
PILKLACMNLSMAETVDFALAIVILIFPLSATVLSYGFIVSTVLQIPSATGQRKAFSTCA
SHLTVVVIFYTAVIFMYVRPRAIASFNSNKLISAIYAVFTPMLNPIIYCLRNKEVKDAIR
KTIAGGRAPALGESIS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacatcaccaacatcagtgagttcatcctcatgggcttccctactgctccatgg
ctgcaaattctgcttttctccatcttcttcataacttatgtgtttgtgcttttggaaaat
ctggtcatcattcttactgtatgggtcactgggtcactgcacaagcctatgtactatttt
ctgagtactatgtcctttctggaggcctggtatatatctgtcactgtccctaagatgctg
gctggattcctatttcaccccaataccatttctttcttgggatgtatgactcagctttac
ttctttatgtcccttgcctgtactgaatgtgtacttttagctgccatggcctatgatcgt
tatgtagccatatgttggcctcttcgctatccagtcatgatgaccacaggattttgtgtt
caactgaccatcagttcttgggtgagtggcttcaccatctccatggcaaaggtgtacttt
ctctcacgagttgccttctgtggcaataatgtcttgaaccattttttctgtgatgtgtca
cccatccttaagttagcttgtatgaacttatctatggctgagacagtagattttgccctt
gccatcgtcatccttatattcccactctcagccactgttctttcctatggcttcattgtc
tctactgtcctgcaaataccatcagccactgggcagcggaaggccttctccacctgtgct
tctcatcttacagtggtggtcatcttctacacagctgtgatcttcatgtatgtccgacct
cgggccattgcttcgtttaattctaacaagctgatctcagccatctatgcagtcttcact
cccatgctcaaccccattatctactgcctgaggaacaaggaagtcaaagatgccatcaga
aaaaccatagcaggtggtagagcaccggccttgggagagtctatttcttaa

DBGET integrated database retrieval system