KEGG   Mus musculus (mouse): 233724
Entry
233724            CDS       T01002                                 

Gene name
Tmem41b, 1500015G02Rik, 1500031M19Rik, AU018901, D7Ertd70, D7Ertd70e, D7Ertd743, D7Ertd743e
Definition
(RefSeq) transmembrane protein 41B
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: SNARE_assoc
Other DBs
NCBI-GeneID: 233724
NCBI-ProteinID: NP_705745
MGI: 1289225
Ensembl: ENSMUSG00000047554
Vega: OTTMUSG00000028635
UniProt: Q8K1A5
Position
7 E3; 7 57.69 cM
AA seq 291 aa
MAKGRVADRSPTEMLHSTPAGDRAVRTQGSAAPGSKDHLNEKPCAEAGSARTSLLILVSI
FSCAAFVMFLVYKNFPQLSEEERVNMKVPRDMDDAKALGKVLSKYKDTFYVQVLVAYFAT
YIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCYMLSYLVGRPVVYKYLT
EKAVKWSQQVERHREHLINYIIFLRITPFLPNWFINITSPVINVPLKVFFIGTFLGVAPP
SFVAIKAGTTLHQLTTAGEAVSWSSVFILMVLALLSILPAIFQKQLKQKFE
NT seq 876 nt   +upstreamnt  +downstreamnt
atggcgaaaggcagagtggctgatcgatcgcccaccgaaatgttgcactcgaccccagcc
ggggaccgggcagtgaggacccagggttccgccgcgcctggcagcaaagatcatctgaac
gaaaagccttgtgcagaagctggatcagcaagaacatcactccttatactggtgtccatt
ttttcatgtgcagcttttgttatgtttttggtatataaaaattttcctcagcttagtgag
gaagagagggtgaatatgaaggttccgagagatatggatgacgccaaggctctaggaaaa
gttctctccaaatataaggataccttttatgtacaagtattggttgcttattttgctaca
tatatttttttgcaaacatttgctatcccaggttccatattcctcagtatactctccggg
ttcctttatcccttcccacttgccttattccttgtttgtttgtgctccggacttggtgcc
tcattctgctacatgctctcctacttagttggaagacccgttgtatacaaatacctaaca
gagaaggcagtgaaatggtcacagcaggtagagcgtcacagagaacatcttattaactac
attatatttttgaggatcacaccgtttcttcctaattggtttattaatattacatctcct
gtgataaatgtaccattgaaagtgttttttattggcacttttctaggtgttgcacctcct
tcttttgtagcaatcaaggcaggaacaactctgcatcagcttacaacagcaggggaagct
gtttcctggagctcggtatttattctgatggttttggcccttctttctatcctgccagcc
atcttccaaaaacaactaaagcagaagtttgagtga

DBGET integrated database retrieval system