KEGG   Mus musculus (mouse): 233733
Entry
233733            CDS       T01002                                 

Symbol
Galnt18, 2900011G21Rik, BC024988, Gal, Galntl4, galNAc-T18, mpp-GalNAc-T18(O18)
Name
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 18
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00512  Mucin type O-glycan biosynthesis
mmu00514  Other types of O-glycan biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    233733 (Galnt18)
   00514 Other types of O-glycan biosynthesis
    233733 (Galnt18)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    233733 (Galnt18)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     233733 (Galnt18)
Glycosyltransferases [BR:mmu01003]
 O-Glycan biosynthesis
  Mucin-type
   233733 (Galnt18)
SSDB
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin
Other DBs
NCBI-GeneID: 233733
NCBI-ProteinID: NP_776100
MGI: 2446239
Ensembl: ENSMUSG00000038296
Vega: OTTMUSG00000024317
UniProt: Q8K1B9
Position
7; 7 E3- F1
AA seq 622 aa
MVCTRKTKTLVSTCVILSGMTNIICLLYVGWVTNYIASVYVRGQEPVPDKKLEEDKGDTL
KIIERLDHLENVIKQHIQEAPAKPEEAEAEPFTDSSLFAHWGQELSPEGRRVALKQFQYY
GYNAYLSDRLPLDRPLPDLRPSGCRNLSFPDSLPEVSIVFIFVNEALSVLLRSIHSAMER
TPSHLLKEIILVDDNSSNEELKEKLTEYVDKVNGQKPGFIKVVRHSKQEGLIRSRVSGWR
AATAPVVALFDAHVEFNVGWAEPVLTRIKENRKRIISPSFDNIKYDNFEIEEYPLAAQGF
DWELWCRYLNPPKAWWKLENSTAPIRSPALIGCFIVDRQYFEEIGLLDEGMEVYGGENVE
LGIRVSEISHTGLSSAPMMVWQCGGSVEVLPCSRIAHIERAHKPYTEDLTAHVRRNALRV
AEVWMDEFKSHVYMAWNIPQEDSGIDIGDITARKALRKQLQCKTFRWYLVSVYPEMRMYS
DIIAYGVLQNSLKTDLCLDQGPDTENVPIVYICHGMTPQNVYYTSSQQIHVGILSPTVDD
DDNRCLVDVNSRPRLIECSYAKAKRMKLHWQFSQGGSIQNRKSKRCLELQENSDMEFGFQ
LVLQKCSGQHWTITNVLRSLVS
NT seq 1869 nt   +upstreamnt  +downstreamnt
atggtgtgtaccaggaagaccaaaactttggtgtccacttgcgtgatcctaagcggcatg
accaacatcatatgcctgctgtacgtgggctgggtcaccaactacatcgccagcgtgtat
gtgcgggggcaggagccagtgcccgacaagaagctggaggaagataaaggggacaccctg
aaaattatcgagcggctggaccacttggagaatgtcatcaaacagcatatccaagaggct
cctgccaagcctgaggaggcagaggccgagcccttcacggactcctccctgtttgcacac
tgggggcaggagctcagcccggaaggccggcgtgtggccctgaagcagttccagtactac
ggctacaacgcctacctcagtgaccggctacccctcgaccggcccctgccagacctcaga
cccagtgggtgccgcaacctctcgttccccgacagcctacctgaggtgagcatcgtgttc
atcttcgtcaacgaggcgctctcagtgctcctgcgttccatccactcggccatggaacgc
acgccatcacacctgctcaaggagatcatcctggtggacgacaacagcagcaacgaggag
ctcaaagaaaagctgactgaatatgtggacaaggtgaacggccagaagccaggcttcatc
aaagttgtgcggcacagcaagcaggaaggcctcatccgctccagagtcagcggctggagg
gcagccacagcccctgtggtggcactgttcgatgcccacgtggagttcaatgtgggctgg
gcggaaccagtcctcacccgcatcaaggaaaaccggaaacggatcatttcaccatctttt
gataacatcaaatatgacaactttgagatagaagagtacccgctagccgcccaaggcttt
gactgggagctgtggtgccgctacctaaacccacccaaggcctggtggaagctagagaac
tccacagccccaatcaggagccctgccctcattggctgtttcattgtggaccggcagtac
ttcgaggagattggcctgctggacgaaggcatggaggtctatggaggggagaatgtggag
cttgggatcagggtgagtgagatttctcacacagggctgagctcagctcccatgatggta
tggcagtgtggcgggagtgtggaggtcctgccctgctctcggattgcccacatcgagcga
gctcacaagccctacacagaggacctcactgcccacgtccgcagaaatgccctcagggta
gctgaagtctggatggatgaattcaaaagtcatgtctacatggcatggaacataccacaa
gaggactcagggattgacatcggggacatcaccgcacgcaaggctctgaggaagcagctg
cagtgcaagaccttcaggtggtacctggtcagtgtgtacccagagatgaggatgtactct
gacattatcgcctatggagtgctgcagaattccctgaagactgatttgtgtcttgatcag
ggcccagatacagagaatgtccccatcgtgtacatatgccatgggatgacaccccagaat
gtgtactacacaagcagccagcagatccacgtgggtatcctgagccccactgtggatgac
gatgacaaccggtgtctggtggacgtcaacagccggccacgtctcatcgagtgcagttac
gccaaggccaagaggatgaagctgcactggcagttctcccagggaggctccatccagaac
cgcaagtccaagcgctgcctggagctgcaagagaacagtgacatggagtttggtttccag
ctggtgcttcagaagtgctcgggacaacactggactatcaccaatgtcctgaggagcctg
gtgtcctga

DBGET integrated database retrieval system