KEGG   Mus musculus (mouse): 233752
Entry
233752            CDS       T01002                                 

Symbol
Insc, 3830422K02Rik, C730020D23
Name
(RefSeq) INSC spindle orientation adaptor protein
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Insc_C INSC_LBD
Other DBs
NCBI-GeneID: 233752
NCBI-ProteinID: NP_776128
MGI: 1917942
Ensembl: ENSMUSG00000048782
Vega: OTTMUSG00000030984
UniProt: Q3HNM7 G3UW77
Structure
Position
7:114342931..114449615
AA seq 532 aa
MMALPGGRHLDSVPLQEQRLHFMQVDSVQRWMEDLKLMTECECMCVLQAKPISLEEDTQG
DLILAGGPGPGDPLQLLLKRGWVISTELRRIGQKLAQDRWARVHSMSVRLTCHARSMVSE
YSTISRTASQEMGQAEKLLMEKCSELSAVTERCLQVENEHVLKSMKACVSETLSLLGEHF
GQLLELALTREVQALVRKIDTSDNIYITESTTGNLFGLTQEGAPLCRIIAKEGGVVALFK
VCRQDSFRCLYPQALRTLASICCVEEGVHQLEKVDGILCLADILTDESHSEATRAEAAAV
VAQVTSPHLSFTQHLTSFLENMEEIVTALIKLCQEASSGEVFLLASAALANITFFDKMAC
EMLLQLNAIRVLLEACGDKQRVDTPYTRDQIVTILANMSVLEQCGSDIIQENGVQLIMGM
LSEKPRSGTPAEVAACERVQQKAAVTLARLCRDPDVAQEAVRLSCMSRLIELCRSPSERN
SSDAVLVACLAALRRLAGVCPEGLQDSDFQQLVQPRLVDSFLLCSNMEESFV
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgatggcactgcctggaggccgccacctggattccgttcctctgcaagagcagaggcta
cacttcatgcaggtagactcggttcagcgctggatggaggatctgaagctcatgaccgag
tgtgagtgcatgtgcgtcttgcaggcaaagcccatcagcctggaggaagacacgcaaggt
gaccttatcctagcaggtggtcctggtccaggagatcctctacagctgctcttgaaacgg
ggctgggtcatcagcaccgagcttcgaaggatcgggcagaagctggcccaggaccgctgg
gcccgtgtgcacagcatgagtgtgcgtctgacgtgccatgcacgctccatggtcagcgag
tacagcaccatcagcaggacagcctcacaggaaatgggccaggcggagaagctgctcatg
gagaaatgctctgagctctctgcggtcacggagaggtgcctccaggtggaaaatgagcat
gttctgaagtcaatgaaggcctgcgtgagtgagaccctgagcctgctgggcgagcacttt
ggtcagctactggagctggccctcacacgggaagtgcaggcacttgtgagaaaaatcgat
acctcagacaatatctacatcacggagtctaccacagggaatctgttcggcctgacccag
gagggggctcctctgtgccgcatcatagccaaggaaggtggggttgtagccctcttcaag
gtctgccggcaggacagcttccggtgcttgtacccccaggcactccgcacactggcctct
atctgctgtgtagaagagggtgtccatcagctggagaaggtggacggtatcctgtgcttg
gctgacatcttgactgatgagagccactcggaggccactagagctgaggctgcagccgtg
gtagcccaggttacctccccacatctgtccttcacccagcacctcactagcttcctggag
aacatggaggagattgtgacagcccttatcaaactgtgccaagaggcctcgtcaggggaa
gtcttcctgctggcctctgcggccctcgccaatatcaccttcttcgacaaaatggcctgt
gagatgcttctacagttgaatgcaatccgtgtcctcctggaagcctgtggtgacaagcag
agagtggacaccccttatactcgggaccagattgtgaccatcttggcaaacatgtctgtg
ctggagcagtgtggctctgacatcattcaggagaacggtgtccagctcatcatgggcatg
ctgtctgagaagccaaggtctgggacacctgctgaagtggcagcctgtgaaagagtacag
cagaaagctgcagtgaccctggcccgcctctgccgagacccagatgtggcccaggaggcc
gttcggctcagctgtatgtctcgcctgattgagctctgccggtccccctctgagaggaac
agtagtgatgctgtcctggtggcctgcctggctgccctgcgtcggttggccggggtctgc
ccggaaggccttcaggactctgacttccagcagctggtccagcctcggctggtggattcc
ttcttactgtgtagcaatatggaggagagttttgtgtag

DBGET integrated database retrieval system