KEGG   Mus musculus (mouse): 233826
Entry
233826            CDS       T01002                                 

Symbol
Palb2, BC066140
Name
(RefSeq) partner and localizer of BRCA2
  KO
K10897  partner and localizer of BRCA2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03440  Homologous recombination
mmu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    233826 (Palb2)
   03460 Fanconi anemia pathway
    233826 (Palb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    233826 (Palb2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     233826 (Palb2)
   FA (Fanconi anemia) pathway
    Downstream FA components
     233826 (Palb2)
SSDB
Motif
Pfam: PALB2_WD40
Other DBs
NCBI-GeneID: 233826
NCBI-ProteinID: NP_001074707
MGI: 3040695
Ensembl: ENSMUSG00000044702
Vega: OTTMUSG00000022651
UniProt: Q3U0P1
Structure
Position
7:complement(121706485..121732203)
AA seq 1104 aa
MEELSGKPLSYAEKEKLKEKLAFLKKEYSRTLARLQRAKRAEKAKNSKKAIEDGVPQPEA
SSQLSHSESINKGFPCDTLQSNHLDEETGENISQILDVEPQSFNCKQGKEVLHTPRAGDI
QGQLLHSTSSPDGKKEQNTLPGTTKTPWEKSSVSQEKEDYFDTNSLALLGKHRKGQESIS
RKNSRTPVSEKTHLLSLRSQIPDPPALVTGIGEGILIPPSGKSERGIDTLVRGNTVSAEA
AVPSCTASNSNHSQHLEHTPPKSGCKITTQGPASSTNLVAQDQKMTIFTVNSVVYKAVRA
HGQLPGSPNSCSVNDLTHSNLPANSTPNSKSLKSPSNTVDERNEPLQEDEILGPSKNFNL
AAVSPPSTESQIHSCTMLEGLLFPAEYYVRTTRRMSDCQRKIALEAVIQSHLGVKKKELK
KKTKATKAVVLSSEDTDQSESGMLDTSTGQSSSGSLSQKLLSPAEVSSPPGPAGKATTPP
PGRGHRGKRKSARTSTLGHCQLLFPPCAALAVNRSKGKFTKHKCQNRGVVIHDFELPDED
FGLLKLEKLKSCSEKLIESPDSKNCGERLPREGNHAALEELQRDSETEGLEEELTVPPGE
AYRPGPTLRRQPGSKDLSSSIVLFTPADTAAPNDSGRPPPSLCSPAFPILGMTPALGSQA
AGETLSTEAAQPCSTSQPPLLGDTNSLVNNSKQCNSSACSPKPDTNLQASGRQGQPACDS
DSGPQATPLPVESFTFRENQLCGNACLELHEHSTEQTETADRPACDNLNPGNLQLVSELK
NPSSSCSVDVSAMWWERAGAKEPCIVTACEDVVSLWKPLNSLQWEKVHTWHFTEVPVLQI
VPVPDVYNLICVALGSLEIREIRALLCSSGDDSEKQVLLKSGDIKAMLGLTKRRLVSSTG
TFCNQQIQIMTFADDGSSKDEQLLMPPDETVLTFAEVQGTQEALLGTTTVNSIVIWNLKT
GQLLKKMHIDDSYQASVCHGAYSEKGLLFVVVSQPCAKESQALGSPVFQLLVINPKTAQS
VGVLLCSLPQGQAGRFLEGDVKDHVAAAVLTSGTIAIWDLLLGHCTALLPPVSDQSWSLV
KWSGTDSHLLAGQKDGNIFIYRYF
NT seq 3315 nt   +upstreamnt  +downstreamnt
atggaagagctttccgggaagcccctcagctatgcggagaaggaaaagttgaaggaaaag
ctagcatttttgaaaaaggaatacagcaggacacttgctcgacttcagcgtgccaaaaga
gctgagaaggctaagaactctaagaaagccatagaagatggtgtgccccagccagaagct
tcctcacagctaagccactctgaatctataaataaaggctttccttgtgacacattgcaa
agcaaccatctggatgaggagactggagaaaacatctctcagatacttgatgttgaacct
caatcctttaactgtaaacaaggcaaagaagtattacatacaccaagagcaggtgacatt
caaggacaacttttgcatagcaccagcagccctgatggcaagaaagagcagaacacgctt
ccggggacaacaaagacgccgtgggagaagtcatctgtttcacaggagaaggaagattat
tttgacactaattctctggcgctccttggtaagcatcgaaaagggcaagaatcaatcagt
aggaagaattctaggactcccgtgagtgaaaagactcaccttttaagtctcaggtctcag
atccctgaccctccagcacttgttacaggaattggagagggtatattaattccgccatct
ggcaaatcagaaaggggaattgatacacttgtgagaggaaatactgtctccgcggaggct
gcagttccttcatgtactgcgtcaaacagcaatcacagtcagcaccttgagcatacacct
cctaaaagtggctgcaaaattactactcagggcccggcttcatccacaaacctggtggca
caagaccaaaaaatgactatatttacagtaaactcagtagtatataaagctgtgcgtgcc
catggtcagctgccaggaagtcccaattcttgttctgtaaatgatctcacgcatagtaac
ttgccagcaaatagtaccccaaactctaaatctttaaaatctcccagtaacactgttgat
gagagaaatgaacctcttcaggaagatgaaattcttggtccatctaagaacttcaacctg
gcagcagtctctcctccttccacagaaagtcaaatacattcttgtactatgcttgaaggc
cttctgtttcctgcagaatactatgttagaacaacccgtcgtatgtcagattgtcagaga
aaaatagctctggaagctgtaattcaaagtcatttgggtgtcaaaaagaaagagcttaaa
aagaaaaccaaagctactaaggcggtcgtcctctccagtgaagacactgaccagagtgaa
agtggcatgctggacacgagcacgggacagtccagttcaggaagcctctctcagaaactg
ctctcaccagctgaggtcagctctcctccaggacctgctggaaaggccaccacaccgcca
cctggtagaggacacagagggaaacgaaaatcagcccgcacctccacactgggtcactgc
cagctgctttttcctccttgtgccgcactggctgttaacaggtccaagggcaaattcacc
aagcataaatgtcagaacagaggcgtggttattcatgactttgagttacctgatgaagac
tttgggcttcttaaacttgaaaaattgaagtcctgctcggaaaaactgattgagtctcct
gactcaaaaaactgtggtgagaggcttcctagagaaggaaaccatgctgctctggaggaa
ctgcaaagagattcggagacggagggcttggaagaggagctcactgttccaccaggagaa
gcgtaccgtccagggccaaccctgagaaggcagccagggagcaaggacctttcttcatcc
atagtgcttttcactcctgcagacactgctgcgcctaacgacagtggcaggcctcctccc
tccctgtgctcacctgctttccccatcttaggcatgactccagctcttggctcccaagca
gccggtgagactctatctactgaagctgcacagccttgctctacatcccaacctcctctc
ttgggagacacaaacagtcttgtcaataacagtaaacagtgcaacagttcagcctgctca
ccaaaaccggacaccaacctgcaagcgtcaggtaggcaaggacaacctgcctgtgacagt
gactctggcccccaagcaacacctctacctgttgagtcattcactttcagagaaaatcag
ctttgtggaaatgcatgcctcgagttacatgaacattccactgaacagactgaaactgca
gatcgccctgcttgtgacaatctaaacccaggaaacctacagttggtttcagagttaaag
aatccttccagttcctgctctgtggatgtgagcgccatgtggtgggaaagagctggtgct
aaggagccatgtatcgtaactgcttgtgaagatgtagtttctctttggaaacccttgaat
tctctgcagtgggagaaagttcatacctggcacttcacagaggttccagtattacaaata
gttccagtgcctgatgtttacaatcttatatgtgtagctttgggaagtttggaaatcaga
gaaatcagggcgttgctgtgctcttctggtgatgacagtgaaaagcaagtcctcctgaaa
tctggagatataaaagctatgcttggcctgacaaagcggaggctagttagtagcactggg
accttttgcaatcaacaaatacaaatcatgacatttgctgacgacggaagcagcaaagat
gaacagcttttgatgcctcctgatgagactgtactgacttttgctgaagtccaagggacg
caggaagctctgcttggtactaccactgtgaacagcattgtgatctggaatttaaaaacc
ggccagctcctgaagaagatgcacattgatgactcctaccaggcttcggtctgtcacgga
gcctattctgagaaggggctcctgtttgttgttgtgagtcaaccttgtgccaaagagagc
caggcccttggaagccctgtgttccagctgctggtgattaaccctaagacggcccagagt
gtgggtgttctgctgtgttcccttcctcaggggcaggctggaaggttcctggaaggggat
gtgaaagatcatgtcgcagcagcagtcctgacttctgggacaattgccatttgggatttg
cttctgggtcactgcacggctctcctcccacctgtctctgaccagagttggtctttggtt
aaatggtcgggtacagattctcacttgctagctggacaaaaggatggaaatatatttata
taccgatacttttaa

DBGET integrated database retrieval system