KEGG   Mus musculus (mouse): 233836
Entry
233836            CDS       T01002                                 

Symbol
Slc5a11, 2010013B02Rik, Kst, Kst1, RKST2, SMIT2, Slc5a10
Name
(RefSeq) solute carrier family 5 (sodium/glucose cotransporter), member 11
  KO
K14391  solute carrier family 5 (sodium/myo-inositol cotransporter), member 11
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    233836 (Slc5a11)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC5: Sodium glucose cotransporter
   233836 (Slc5a11)
SSDB
Motif
Pfam: SSF IBV_3C
Other DBs
NCBI-GeneID: 233836
NCBI-ProteinID: NP_666310
MGI: 1919316
Ensembl: ENSMUSG00000030769
Vega: OTTMUSG00000030939
UniProt: Q8K0E3
Position
7; 7 F3
AA seq 673 aa
MESATISPQPPQSDSLEAFPQKSMEPADIAVLVLYFLFVLAVGLWSTVRTKRDTVKGYFL
AGGDMVWWPVGASLFASNVGSGHFIGLAGSGAAVGISVAAYELNGLFSVLMLAWVFLPIY
IAGQVTTMPEYLRRRFGGNRISITLAVLYLFIYIFTKISVDMYAGAIFIQQSLHLDLYLA
IVGLLAITALYTVAGGLAAVIYTDALQTVIMLIGAFILMGYSFAAVGGMEGLKDQYFLAL
ASNRSENSSCGLPREDAFHIFRDPLTSDLPWPGILFGMSIPSLWYWCTDQVIVQRSLAAK
NLSHAKGGSLMAAYLKVLPLFLMVFPGMVSRVLFPDQVACAHPDICQRVCSNPSGCSDIA
YPKLVLELLPTGLRGLMMAVMVAALMSSLTSIFNSASTIFTMDLWNHIRPRASERELMIV
GRIFVFALVLVSILWIPIVQASQGGQLFIYIQSISSYLQPPVAMVFIMGCFWKRTNEKGA
FSGLILGLLLGLVRLILDFVYAQPRCDQPDDRPAVVKDVHYLYFSMILSFTTLITVVTVS
WFTETPSKEMVSRLTWFTRHEPVAQKDSAPPETPLSLTLSQNGTTEAPGTSIQLETVQES
TTKACGDGVSPRHSKVVRAILWLCGMEKNKEEPPSKAEPVIVSLEENPLVKTLLDVNCIV
CISCAIFLWGYFA
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggagagtgccaccatcagccctcagcccccacagtctgactccctggaggcctttccc
cagaagagcatggagcctgcagacatcgctgtcctagttctgtacttcctctttgttctg
gctgttggattatggtccacagtgaggaccaaacgagacacagtgaaaggctacttcctg
gctggaggggacatggtgtggtggccagtgggtgcatccttgttcgccagcaatgttgga
agtggacacttcattggcctcgctgggtctggtgctgctgtgggcatttctgtcgctgcc
tatgagcttaatggcttgttttctgtgctgatgctggcctgggtcttccttcctatctac
attgctggccaggtaaccacgatgccagaatatctaaggcggcgctttgggggcaacagg
atctccatcaccctggctgtgctctacctgttcatctacatcttcaccaagatctcggtc
gacatgtatgcaggggccatcttcattcagcagtccttgcatctggatctgtacctggcc
atagtagggctgctggcaatcacagctctgtacactgttgcaggaggtctggccgctgtg
atctatacagatgctctgcagactgttatcatgcttataggagccttcatcctcatgggc
tacagttttgcagctgttggtggaatggaaggcctgaaggaccagtacttcttagccctg
gctagtaaccggagtgagaacagcagctgtgggctaccccgagaagatgccttccacatc
ttccgagatccattgacatctgatctcccctggcctgggatcctgtttggcatgtccatc
ccatctctctggtattggtgtacagatcaggtgattgttcagcggagtctggctgccaag
aacctgtctcatgccaaaggcggctccctgatggctgcgtacctgaaagtgcttcctctt
ttcctgatggtgttccctgggatggtcagcagagtcctcttcccagatcaagtagcctgt
gcgcatcctgacatctgccagagggtctgtagcaacccctctggctgttcagacatcgcg
taccccaaacttgtgctggaacttctgcccacaggactccgtgggctcatgatggctgtg
atggtggcggctctcatgtcctccctcacctccatctttaacagtgccagcaccatcttc
accatggacctgtggaaccacatccggccacgggcatctgaaagggagctcatgattgtg
ggcaggatatttgtgtttgccctggtgctggtctccatcctctggatccccattgtgcag
gccagccagggagggcagcttttcatctacattcaatccatcagctcctacctgcagcca
cctgtggccatggtcttcatcatgggatgtttctggaagcgtaccaatgaaaagggtgcc
ttctcaggcctgatcttgggcttgctgctgggactggtcaggctgatcctggactttgtc
tacgcgcagcctcggtgtgaccagcctgatgaccggccagctgtggtgaaggatgtccac
tacctctacttctccatgattctgtcttttaccaccctcatcactgtggtcactgtgagc
tggttcacagagacaccctccaaagagatggtcagccgcctgacttggttcactcgtcat
gaacctgtggcccagaaggactcagcaccaccagaaacccccctgtctctaaccctttct
cagaatgggactacagaggcccctggcaccagcatccagctggagacagttcaagaaagt
acgaccaaagcctgtggcgatggtgtgtctcccaggcattccaaggtggtgagggctatc
ctgtggctctgtgggatggaaaagaacaaagaggagcccccaagcaaagcggaacctgtc
atagtttccttggaggaaaatcccttggtgaaaaccctgcttgacgtcaactgcattgtg
tgcatcagctgcgccatcttcctttggggatacttcgcataa

DBGET integrated database retrieval system