KEGG   Mus musculus (mouse): 233876
Entry
233876            CDS       T01002                                 

Gene name
Hirip3, B130036O03, C86302
Definition
(RefSeq) HIRA interacting protein 3
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: CHZ
Other DBs
NCBI-GeneID: 233876
NCBI-ProteinID: NP_766334
MGI: 2142364
Ensembl: ENSMUSG00000042606
Vega: OTTMUSG00000023359
UniProt: Q8BLH7
Position
7; 7 F3
AA seq 601 aa
MAPGDEMRKFTRSFFRACPDLSSVTHAIVRQKFLIHVGRDHLEPEEKQALKRLVEEELPK
MQADAGTREGKPDFIKVKRSPAPCSDPKKKRFRFNSESESSSSPSSPDGSGPSTKNRTTK
KTCLRRALKKAVESTDEDHQTDLDAKMGLEESSEGEAEGSVRSGKVTEEEEDMKQEQKGQ
VRKQAGAKDKQVPLKADRKQVREESGSSEEEAVLQRAKVEGSTGANCQEESEESGEESPA
KKKELSEPRSRSNRAERTARERKSYKQKSRPGRPTGGLRDSEAEKEGGTVGSGDSSEEGE
AEKEGGTVGSGDSSEKGEAEKEEGTVGSGDSSEEGEEHSVKRKSKVRTQTESGRRQNTSS
RDDSNSTQEQAAAQGTTKSGSLGSSNGDSDTEREVSDSQAGQNTKEERKSRSSNKSSKNG
QARSCSSSSDSSPEPTGQKGKARSSSSSSDSGPEPTGRKAASRCGEDHPAVARLKRYIRA
CGAHRNYKKLLGSCSSHKARLSVLRAELEALGMKGNPSLEKCRALKLQREEAAEVAALDV
ANIISSTGRPRRRNAWNPSGEGTSPGETYRRTLDSEEEQPRQAPPDWSHMRDIISSDGDS
S
NT seq 1806 nt   +upstreamnt  +downstreamnt
atggcgccgggagatgagatgcgaaaattcactcgcagcttctttcgagcttgcccggac
ctcagctcggttacgcacgccatcgtgcgacagaaatttttgattcacgtgggtcgggat
catcttgaacctgaagagaagcaggcgttgaagcggctggtggaggaggagctgccgaaa
atgcaggcggatgctggtaccagggaaggaaagccagactttatcaaagtgaagaggtct
cctgctccctgcagtgacccaaagaagaaaaggttccgctttaattcagagtcagaatcc
agctcttcaccatccagtccagatggctcaggaccctcaacaaagaacaggacaaccaag
aagacatgtctaagaagagccttaaagaaagcagttgagagcacagatgaagaccaccaa
acagacctggatgcaaagatgggattggaggagagcagtgagggggaagcagagggctct
gttagatcaggtaaggtcaccgaggaagaggaggacatgaaacaagaacagaagggccag
gttagaaagcaagctggggccaaagacaagcaagtaccactcaaggcagacaggaagcag
gttagggaagagagtgggagcagtgaggaggaggctgtgctgcagagagcaaaggtggag
ggaagcacaggtgctaactgccaggaggagagtgaagagagcggagaggagagcccagct
aagaagaaagagcttagtgagcccagatccagaagtaacagagcagagagaacagccagg
gagagaaagagctataagcagaaaagcaggcctgggaggccaactggaggcttgcgagac
agcgaggcagagaaggaagggggcacagtgggcagtggggacagcagtgaggagggggag
gcagagaaggaaggaggcacagtgggcagtggggacagcagtgagaagggggaggcagag
aaggaagagggcacagtgggtagtggggacagcagtgaggagggagaagagcactcggtg
aagagaaagagcaaggtcaggacccagaccgagagtgggaggaggcagaacacaagcagc
agggatgacagtaacagcacacaggagcaagcagctgctcaaggcactacaaagtcaggc
agcctaggcagcagtaatggtgacagtgacacagagagggaagtgagtgactcccaggca
ggacaaaacaccaaagaggagaggaagagccgctcttccaacaagagctccaagaacggc
caggcccgaagttgttcatcttcatcagattcgagtccagaacccacaggtcagaagggc
aaggcccgaagttcctcatcttcatcagattcaggtccagaacccacaggtcggaaggct
gcctctcgctgtggagaggaccacccagctgtggctagactaaagcgttacattcgagcc
tgtggtgcccaccgaaactacaagaagctgctgggctcctgcagctcccacaaggcgcgc
ctgagtgtcctcagggctgagctggaagcactgggcatgaaggggaacccttccttggag
aagtgtcgcgctctgaagctgcagcgggaagaggcagctgaagtggctgccctggatgtt
gccaacatcatcagcagtacaggccggccacgaagacgaaatgcctggaacccttcaggg
gaagggacctccccaggagagacttatcgccgaaccctggactcagaagaggagcagccg
cgccaagcacctccagactggtcccatatgcgtgatatcatcagcagtgacggtgacagc
agctga

DBGET integrated database retrieval system