KEGG   Mus musculus (house mouse): 233878
Entry
233878            CDS       T01002                                 
Symbol
Sez6l2, AI835913, AW121566, BSRP-A, Psk1
Name
(RefSeq) seizure related 6 homolog like 2
  KO
K24363  seizure protein 6
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    233878 (Sez6l2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Other domain-containing proteins
  CUB domain-containing proteins
   233878 (Sez6l2)
SSDB
Motif
Pfam: Sushi CUB
Other DBs
NCBI-GeneID: 233878
NCBI-ProteinID: NP_001239495
MGI: 2385295
Ensembl: ENSMUSG00000030683
UniProt: Q4V9Z5
Position
7:126549665..126569782
AA seq 910 aa
MGTPKAQHPPPSQLLLLILLSCAWIEGLPLKEDEMMPEPGSETPTVASEDLAELLHGALL
RKGPEIGFLPGSDPDPTLATPPAGQTLAAPSLPRATEPGTGPLTTAVTPKGVRGAGPTAP
ELLTPPPGTTAPPPPGPASPVPPLRPEGGEEETTTTIITTTTVTTTVTSPVLCNNNISEG
EGFVESPDLGSTASRSVELLDCTYSIHVYPGYGIEIQVQTLNLSQEEELLVLAGGGSPGL
APRLLANSSMLGEGQVLRSPTNRLLLHFQSPRVPRGNGFRIHYQAYLLSCGFPPRPAHGD
VSVTDLHPGGTATFHCDSGYQLQGEETLICLNGTRPAWTGEPPSCTASCGGTIHNATLGR
IVSPEPGGAAGPNLTCRWVIEAAEGRRLHLHFERVSLDEDNDRLMVRSGGSPLSPVIYDS
DMDDVPERGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFPPFLAHGNVTTTDPE
FHPGALATFSCLPGYALEPPGPPNAIECVDPTEPHWNDTEPACKAMCGGELSEPAGVVLS
PDWPQSYSPGQDCVWGLHVQEEKRILLQVEILNVREGDMLTLFDGDGPSARVLAQLRGPQ
PRRRLLSSGPDLTLQFQAPPGPPNPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASHG
DLIRGTVLTYQCEPGYELLGSDILTCQWDLSWSAAPPACQKIMTCADPGEITNGHRTASD
AGFPVGSHVQYRCLPGYSLEGAAVLTCYSRDTGTPKWSDRVPKCALKYEPCLNPGVPENG
YQTLYKHHYQAGESLRFFCYEGFELIGEVTITCVPGHPSQWTSQPPLCKVTQTTDPSRQL
EGGNLALAILLPLGLVIVLGIGVYIYYTKLQGKSLFGFSGSHSYSPITVESDFSNPLYEA
GDTREYEVSI
NT seq 2733 nt   +upstreamnt  +downstreamnt
atggggactcccaaggcccagcacccgccgccttcccagctgctgctcctaattctgctg
agctgtgcctggattgagggtctgcccctgaaggaggatgagatgatgccagagcctgga
agtgagactcccacagtggcctctgaggacctggctgagctgctccatggggctttgctg
cggaagggcccagagatcggcttcttgccgggatctgacccagaccccacactagccacc
cctccagccggccagactcttgcagcaccttccctgccacgtgccactgagccagggaca
gggcctctgacgacagctgtcacccccaagggagtcaggggggcaggccccaccgcgcca
gagctgctgaccccaccccctggaactacagccccgcccccgcctggccccgcctcccca
gtcccacccctcaggcctgagggaggagaggaggaaaccaccaccaccatcatcaccaca
acaactgtcaccaccactgtcaccagcccagttctgtgcaataacaacatctcggagggc
gaagggtttgtggagtctccggacttggggagcactgccagccgctccgtggagctccta
gattgcacctacagcatccatgtctaccctggttatggcattgagattcaggtgcagaca
ctcaacctgtctcaggaggaagaacttctggtgttggccggtgggggttctccaggcctg
gcccccagactcctggccaattcctccatgctgggagaaggacaagtgctgcggagccca
acaaaccggctgctcctgcatttccagagtcctcgagtcccaaggggcaatggcttcagg
attcactatcaggcataccttctgagctgcggcttcccaccccggccagcccacggggat
gtgagcgtgacagacttgcatcctgggggcactgccaccttccactgtgactcaggatac
cagctacagggtgaggagaccctcatttgcctcaatggtacccggccagcctggactggt
gaaccccctagctgtacagcatcttgtggtggcaccatccacaatgccacactgggtcgc
attgtatcccctgagcctgggggagctgcagggcccaacctcacctgccgctgggtcatt
gaagcggccgagggacgccggcttcacctacactttgagagagtctcactggatgaggac
aatgaccggctgatggtgcgctcagggggaagccccctgtcccctgtgatttacgactct
gacatggatgatgtccctgaacgcggtctcatcagtgatgcccagtccctctacgtagaa
ctgctttcagagacaccagccaaccccctgctgctcagcctccgatttgaagcctttgag
gaggaccgctgcttccccccgttcctggctcacggcaatgtgaccactacagatcctgag
ttccacccaggagcactggccaccttctcatgcctcccaggatatgctctggagccacca
ggaccccccaatgctatcgaatgtgtggatcccaccgaaccccactggaacgacacagag
ccagcctgcaaggccatgtgtggaggagagctgtctgagccagctggtgtggtactctct
cccgactggccccagagttacagccctggccaagactgcgtgtggggcctgcacgtccag
gaagagaagcgcatcttgctccaagttgaaatcttgaatgttcgcgaaggggatatgcta
acactgttcgacggggacggtccgagcgctcgagtcctggcccagctgcgaggacctcag
ccgcgccgccgcctcctctcctctggacctgatctcactctgcagtttcaggcaccccct
ggtcccccaaatccgggcctaggccagggtttcgtgttacatttcaaagaggtcccgaga
aacgatacgtgcccggagctaccaccacctgagtggggctggaggacagcatcccacggg
gaccttatccggggtacagtgctcacctatcaatgcgagcctggctatgaactactggga
tcagacatcctcacttgccaatgggacctgtcctggagcgcggcgccacctgcctgccaa
aagatcatgacttgtgctgaccctggcgagatcaccaatggccatcggactgcctcagat
gctggtttccctgtgggctcccacgtccagtatcgctgtctgccagggtacagcctggaa
ggagcagctgtgctcacctgctacagccgggacacaggcacacccaagtggagtgatcgg
gtccccaaatgcgccttaaagtacgagccgtgcctgaaccccggtgttcctgagaatggt
taccaaactctgtacaagcatcactaccaagcgggcgagtcgctacgcttcttctgctac
gagggctttgagctcatcggcgaggtcaccatcacatgtgtacccggtcacccctcccag
tggaccagccagcccccactctgcaaagtgacccagactacagacccatcacggcagctg
gagggtggtaatctcgctttggccatcctgttgcccctgggcttggtcattgtccttggc
attggcgtttacatatactacactaagctacaaggaaaatccctctttggcttctcgggt
tctcactcttacagtcccattacggtggagtcagacttcagcaacccactgtatgaagct
ggggatacgagggagtatgaagtttccatctga

DBGET integrated database retrieval system