KEGG   Mus musculus (mouse): 233890Help
Entry
233890            CDS       T01002                                 

Gene name
Zfp768, BC026432, Znf768
Definition
(RefSeq) zinc finger protein 768
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    233890 (Zfp768)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    233890 (Zfp768)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    233890 (Zfp768)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 Zn-ribbon_8 zf-Di19 zf_UBZ zf-met zinc_ribbon_15 XPA_N zf-C2HC_2 Zn_ribbon_SprT HypA OrfB_Zn_ribbon zf-LYAR
Motif
Other DBs
NCBI-GeneID: 233890
NCBI-ProteinID: NP_666314
MGI: 2384582
Ensembl: ENSMUSG00000047371
Vega: OTTMUSG00000058503
UniProt: Q8R0T2
Position
7; 7 F3
AA seq 568 aa AA seqDB search
MEREASSWGLESRDVHSPNAVGSPEGSLKDPAGNTSENEEGEISQREGNGDYEVEEIPFG
LEPQSPEFEPQSPEFESQSPRFEPESPGFESRSPGFVPPSPEFAPRSPESDPQSPEFESQ
SPKYEPRSPGCHPRSPGCEPGSPRYEPKSPGYGSKSPEFESQSPGYESQSPGYEPQNSGD
GVQNSEFKTHSPEFETQSSKFQEGAEMPLSPEEKNPLSISLGVHPLDSFTQGFGEQPTGA
LPPFDMPSGALLAAPQFEMLQNPLNLTGTLRGPGRRGGRARGGQGPRPNICGICGKSFGR
GSTLIQHQRIHTGEKPYKCEVCSKAFSQSSDLIKHQRTHTGERPYKCPRCGKAFADSSYL
LRHQRTHSGQKPYKCPHCGKAFGDSSYLLRHQRTHSHERPYSCPECGKCYSQNSSLRSHQ
RVHTGQRPFSCGICGKSFSQRSALIPHARSHAREKPFKCPECGKRFGQSSVLAIHARTHL
PGRTYSCPDCGKTFNRSSTLIQHQRSHTGERPYRCAVCGKGFCRSSTLLQHHRVHSGERP
YKCDDCGKAFSQSSDLIRHQRTHAAGRR
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggagcgggaggcgtcgtcgtggggcctggagtcccgggatgtgcacagtcccaacgca
gtgggcagccccgaagggtctctcaaagatcctgcaggcaacacaagtgagaatgaagaa
ggggaaatttctcagcgagaaggcaatggggactatgaagttgaagaaataccttttggg
cttgaaccccaaagcccagagtttgagccacaaagcccagaatttgaatcccagagcccc
aggtttgagcctgaaagcccagggtttgaatcccgaagccctgggtttgtgcccccaagc
cctgagtttgcacccagaagtcctgaatcagatcctcagagcccggagtttgaatcccag
agtcctaagtatgagccccgaagccctggctgccatcccaggagccctggctgtgaacct
gggagtcctaggtatgaacccaaaagccctgggtacggttcaaagagccccgaatttgaa
tctcaaagtccagggtatgaatctcagagccccgggtatgaaccgcagaactctggagat
ggcgttcagaattctgagttcaaaacccatagccctgagtttgaaactcaaagttccaaa
ttccaggaaggtgcagagatgcctctgagccccgaggaaaagaatcccttgagcatctcc
ctaggagtccaccccctggattcctttactcaagggtttggggagcagcccacaggagcg
ctgcctccatttgacatgccttcgggggctctgctggctgcaccccagtttgagatgctc
cagaatccactgaatctgacaggaaccctgcgtgggccaggccgtaggggtggccgggcc
aggggtgggcaaggccctcgacctaacatctgtggcatctgcgggaagagctttggacga
ggctcgaccctgatccagcaccagcgcatccataccggcgagaagccttacaaatgtgag
gtttgcagcaaggccttttcccagagctctgacctcatcaaacaccagcgcacgcataca
ggcgagcggccctacaagtgtcccaggtgcggcaaggccttcgctgatagctcttaccta
ctccgccaccagcgtacccactctggccagaagccctacaaatgtccacactgtgggaag
gcctttggcgacagctcctacctcctgcgacaccagcgcacccacagccacgagaggccc
tacagctgccccgagtgtggcaagtgctatagccagaactcgtccctgcgcagtcaccaa
agggtgcacactgggcaacggcctttcagctgtggcatctgtggcaaaagcttctcccaa
cggtcagcacttatcccccacgcccgcagccacgcccgtgaaaagcccttcaagtgccca
gagtgcggcaagcgcttcggccagagctcagttctggccatccatgcccgcacccacctg
ccaggccgcacgtacagctgccccgattgtggcaagaccttcaaccgctcctctacactc
attcagcaccagcgttcccacacaggcgagaggccgtaccgctgcgctgtgtgtggcaag
ggcttctgtcgctcctccacgctgctacagcaccatcgcgtgcatagtggggagcgacct
tataagtgtgatgactgtggaaaggccttctcgcagagctccgacctcatccgccaccag
cggacccacgcagccggccgccgttaa

DBGET integrated database retrieval system