KEGG   Mus musculus (mouse): 233893
Entry
233893            CDS       T01002                                 

Gene name
Zfp764, 8030466O12Rik
Definition
(RefSeq) zinc finger protein 764
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    233893 (Zfp764)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    233893 (Zfp764)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    233893 (Zfp764)
SSDB
Motif
Pfam: KRAB
Other DBs
NCBI-GeneID: 233893
NCBI-ProteinID: NP_001161304
MGI: 2443580
Ensembl: ENSMUSG00000045757
Vega: OTTMUSG00000022482
UniProt: Q8C964
Position
7; 7 F3
AA seq 133 aa
MAQRMARGRAWAPPASCKPEAVSFADVAVYFSPEEWRCLRPAQRALYREDLEAPNQHSSA
GWRKSPKCGDPVHRIQRWPCAGQKSTQIAGTRRKGRDQEKRLKQCRRHFLQNLGRRSHNS
HLLAPLVEFKPRS
NT seq 402 nt   +upstreamnt  +downstreamnt
atggcgcagaggatggcccggggaagggcctgggctccgcctgcgtcctgtaaacccgag
gctgtgagcttcgcggacgtggccgtgtacttctccccggaggagtggaggtgtctgcgg
ccggcgcagagagccctgtaccgagaggacttggaggcgccaaaccagcactcatctgct
gggtggaggaagagtccgaagtgtggggaccctgtgcacaggatccagaggtggccatgt
gcaggacagaagtccactcagattgcaggcacgagaaggaaaggaagagaccaagagaag
agactgaagcaatgcagaagacattttctccagaacctgggcagaaggagccacaactct
catttgctggctccgctagtggaattcaagccacggtcctaa

DBGET integrated database retrieval system