KEGG   Mus musculus (house mouse): 234069
Entry
234069            CDS       T01002                                 
Symbol
Pcid2, A730042J05Rik
Name
(RefSeq) PCI domain containing 2
  KO
K23801  nuclear mRNA export protein PCID2/THP1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    234069 (Pcid2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    TREX-2 complex
     234069 (Pcid2)
SSDB
Motif
Pfam: PCI
Other DBs
NCBI-GeneID: 234069
NCBI-ProteinID: NP_848823
MGI: 2443003
Ensembl: ENSMUSG00000038542
UniProt: Q8BFV2
Position
8:complement(13125476..13155343)
AA seq 399 aa
MAHITINQYLQQVYEAIDTRDGASCAELVSFKHPHVANPRLQMASPEEKCQQVLEPPYDE
MFAAHLRCTYAVGNHDFIEAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRIFAN
NADQQLVKKGKSKVGDMLEKAAELLMSCFRVCASDTRAGIEDSKKWGMLFLVNQLFKIYF
KINKLHLCKPLIRAIDSSNLKDDYSTAQRITYKYYVGRKAMFDSDFKQAEEYLSFAFEHC
HRSSQKNKRMILIYLLPVKMLLGHMPTIELLRKYHLMQFSEVTKAVSEGNLLLLNEALAK
HETFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMHVEDVDIDEV
QCILANLIYMGHIKGYISHQHQKLVVSKQNPFPPLSTVC
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggcgcacatcaccattaaccagtacctacagcaggtatatgaagccatcgacaccaga
gatggagcatcctgtgcagagctggtatcctttaagcaccctcatgttgcgaacccacgg
ctccagatggcctctccagaagagaaatgccagcaagttctggagcccccatatgatgaa
atgtttgcagctcatttaaggtgtacctatgctgtggggaatcacgacttcatagaagcg
tacaagtgccagacggtgatagtccaatcattcctccgggcattccaggctcacaaagag
gaaaactgggctctgcctgtcatgtatgcagtagcacttgaccttcggatatttgccaat
aatgcagaccagcagttggtaaagaaagggaagagcaaagttggagacatgctggaaaaa
gctgccgagctgctgatgagctgcttccgagtctgtgccagtgacacccgtgccggcata
gaagactctaagaagtgggggatgctgttcctggtgaaccagctatttaaaatctacttt
aagatcaacaaactccatttgtgtaaacctcttatcagagccatcgacagctcgaatctg
aaagatgactatagcacagcgcagaggatcacgtacaagtactacgtggggcgcaaggcc
atgtttgacagtgacttcaagcaagcggaggagtacctgtcgtttgcctttgaacactgc
catcgctccagccagaagaacaagaggatgattctgatctacctgctgccagtgaagatg
ctgctgggtcacatgccgaccatcgagctcctgaggaaataccacctgatgcagttttca
gaagtgaccaaagccgtcagtgagggcaacctgctgctgctcaatgaggcgctggcaaag
cacgagacgttcttcatccgctgtggcatcttcctcatcctggagaagctgaagatcatc
acgtacaggaacctcttcaagaaagtgtatttgttactcaagacacatcagctgtcccta
gacgcctttctggtcgctttgaagttcatgcacgtggaagacgtggacattgacgaggtc
cagtgcattctggccaacttgatatacatgggtcacattaaaggctacatctcccatcag
catcagaaactggtcgtcagcaagcagaaccctttccctccgctgtccacagtgtgctga

DBGET integrated database retrieval system