KEGG   Mus musculus (house mouse): 234258
Entry
234258            CDS       T01002                                 
Symbol
Neil3, AI449477, BC034753, C85903
Name
(RefSeq) nei like 3 (E. coli)
  KO
K10569  endonuclease VIII-like 3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    234258 (Neil3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    234258 (Neil3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     234258 (Neil3)
SSDB
Motif
Pfam: zf-GRF H2TH zf-RanBP Fapy_DNA_glyco zf-FPG_IleRS
Other DBs
NCBI-GeneID: 234258
NCBI-ProteinID: NP_666320
MGI: 2384588
Ensembl: ENSMUSG00000039396
UniProt: Q8K203
Structure
Position
8:complement(54039902..54092100)
AA seq 606 aa
MVEGPGCTLNGEKIRARVLPGQAVTGVRGTALQSLLGPAMSPAASLADVATSAAPMNAKD
SGWKLLRLFNGYVYSGVETLGKELFMYFGPRALRIHFGMKGSILINPREGENRAGASPAL
AVQLTRDLICFYDSSVELRNSVESQQRVRVMEELDICSPKFSFSRAESEVKKQGDRMLCD
VLLDQRVLPGVGNIIKNEALFDSGLHPAVKVCQLSDKQACHLVKMTRDFSILFYRCCKAG
SAISKHCKVYKRPNCDQCHSKITVCRFGENSRMTYFCPHCQKENPQCVQVCQLPTRNTEI
SWTPRGEDCFTDSVARKSEEQWSCVVCTLINRPSAKACDACLTTRPLDSVLKNRENSIAF
NNLVKYPCNNFENTHTEVKINRKTAFGNTTLVLTDLSNKSSALARKKRANHTIDGESQMF
LPTDIGFSDSQHPSKEGINYITQPSNKVNISPTVCAQSKLFSSAHKKFKPAHTSATELKS
YNSGLSNSELQTNRTRGHHSKSDGSPLCKMHHRRCVLRVVRKDGENKGRQFYACSLPRGA
QCGFFEWADLSFPFCRHGKRSIMKTVLKIGPNNGKNFFVCPLEKKKQCNFFQWAENGPGM
EIVPGC
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggtggaagggccagggtgtacactgaatggagagaagatccgggcacgagtgctaccg
gggcaggcggtgactggtgtgcggggcacagctctgcagagcctcctgggccctgccatg
tcccctgccgcctccctggctgatgtcgctacctcggctgctccaatgaatgctaaggat
tctggctggaaactcttgagactgtttaatggatatgtttacagtggcgtggaaacctta
gggaaggagctgtttatgtactttggccccagagctttacggattcatttcggaatgaaa
ggctccatcttgattaacccacgggagggtgagaacagagctggggcttctccagccttg
gcggtgcagctcaccagagacttgatctgcttctatgactcttcagtagaactcagaaat
tcggtggaaagccaacagagagtcagagtgatggaagagttggatatatgttcaccaaag
ttcagtttctcaagagcagagagtgaagtgaaaaagcagggagatcggatgctgtgtgat
gtgttgctggatcagagggtgttgcctggcgtgggcaacatcatcaaaaatgaagcactc
tttgacagtggtcttcatccggctgttaaggtgtgtcaactatcagacaaacaggcctgt
caccttgtgaagatgactcgggatttcagcattctcttctacaggtgctgtaaagcagga
tctgccatttctaaacactgtaaggtttacaagcgtcctaactgtgatcagtgccacagc
aaaattactgtgtgtcgctttggggagaacagcaggatgacatatttctgtcctcactgt
cagaaagaaaaccctcaatgtgttcaagtatgccagctgccaacaagaaacactgaaatc
agctggactcctaggggagaggattgctttacggactcagtggctcggaagtctgaagag
cagtggtcctgtgtggtttgtactctcataaacagaccctcggctaaggcctgtgatgct
tgcttgaccacaaggcctctggattcagtgctcaagaatagagaaaattccattgccttc
aacaacttagtgaagtacccttgtaataactttgagaacacacacactgaagtaaagatc
aacaggaaaactgcgtttggaaatacgacccttgttttgactgatttaagcaataaatcc
agtgctttggccagaaagaaaagagcaaaccacacaatagatggggaatctcaaatgttt
ctccctacagacataggttttagtgattcacagcacccctccaaagaaggaataaactat
ataactcaaccatccaataaggtaaacatatcacctacagtttgtgcccagtctaaatta
tttagttcagcacataaaaaattcaaaccagctcacacttctgcaacagaacttaaaagt
tacaactctggactttctaacagtgaactccaaaccaataggacacgtggccatcattcc
aaaagtgatggcagccctctgtgcaagatgcaccaccgccgttgtgttctccgagttgtg
aggaaagatggagaaaacaaggggaggcagttttatgcctgttctctgccgagaggagca
cagtgcggattttttgaatgggcagacctgtccttcccgttctgcagacatggcaagcgc
tccattatgaaaactgtgctgaagattggacctaataatgggaagaatttttttgtatgt
cctttggagaaaaaaaagcagtgtaattttttccagtgggccgaaaatggaccaggaatg
gaaattgttccaggatgctaa

DBGET integrated database retrieval system