KEGG   Mus musculus (house mouse): 234290
Entry
234290            CDS       T01002                                 
Name
(RefSeq) cDNA sequence BC030500
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Asn_synthase
Other DBs
NCBI-GeneID: 234290
NCBI-ProteinID: NP_775587
MGI: 2447770
Ensembl: ENSMUSG00000049946
UniProt: Q8K0R8
Position
8:59364789..59367332
AA seq 123 aa
MSSVTGLYRETGSSLSSPERRQARNSGVQVALSGRAMEEFLHGPDGIAARKARQRQRAEA
TQSGLVPERRVSPEPTAQARYVAWKEKEDSHAAWTALLAAASRQHCGEQRQLSGSRPAPG
AQV
NT seq 372 nt   +upstreamnt  +downstreamnt
atgtcaagtgtgaccgggctttacagggagactggttcgtctctgagctcacccgaaagg
cgccaggccagaaattccggagtacaagtcgccctgagcgggagggcaatggaagaattc
ctccatggtcctgatgggatcgcagcgaggaaggcgcggcagcgacagcgagcagaggca
acccagtctggactggtccctgagaggagggtttccccagaacctacagctcaagccagg
tacgtagcgtggaaggagaaagaggattcccacgccgcgtggacagcgttgttagccgca
gcttccagacaacactgtggagaacagaggcagctcagcgggagtcggccagcacctggg
gcccaggtttag

DBGET integrated database retrieval system