KEGG   Mus musculus (mouse): 234356
Entry
234356            CDS       T01002                                 

Gene name
Csgalnact1, 4732435N03Rik, CSGalNAcT-1
Definition
(RefSeq) chondroitin sulfate N-acetylgalactosaminyltransferase 1
  KO
K00746  chondroitin sulfate N-acetylgalactosaminyltransferase 1/2 [EC:2.4.1.174 2.4.1.175]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
mmu01100  Metabolic pathways
Module
mmu_M00058  Glycosaminoglycan biosynthesis, chondroitin sulfate backbone
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    234356 (Csgalnact1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    234356 (Csgalnact1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.174  glucuronylgalactosylproteoglycan 4-beta-N-acetylgalactosaminyltransferase
     234356 (Csgalnact1)
    2.4.1.175  glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase
     234356 (Csgalnact1)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  O-Glycan
   234356 (Csgalnact1)
SSDB
Motif
Pfam: CHGN Glyco_transf_7C Glyco_tranf_2_2
Other DBs
NCBI-GeneID: 234356
NCBI-ProteinID: NP_001239552
MGI: 2442354
Ensembl: ENSMUSG00000036356
Vega: OTTMUSG00000024914
UniProt: Q8BJQ9
Position
8; 8 B3.3
AA seq 530 aa
MVRRGLLGWISRVVILLVLLCCAISVLYMLACTPKGDQEQLGLPRANGPTGKDGYQAVLQ
EREEQHRNYVNSLKRQIAQLKDELQARSEQFRSGQDQASDATSLRSGWDREPKAQADLLA
FLRGQVDKAEVHAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDELVE
AIESALESLNSPVESSPHQRPYTAADFIEGIYRTERDKGTLYELTFKGDHKHEFQRLVLF
RPFGPIMKVKKEKLNLANTLINVIVPLARRVDKFRHFMQNFREMCIQQDGRVHLTVVYFG
KEEMNEVKGILENTSKAANFRNFTFIQLNGEFSRGKGLDVGARFWKGSNVLLFFCDVDIY
FTSEFLNTCRLNTQPGKKVFYPVLFSQYNPGVIYGHHDAVPPLGQQLVIKKETGFWRDFG
FGMTCQYRSDFINIGGFDLDIKGWGGEDVHLYRKYLHSNLIVVRTPVRGLFHLWHEKHCM
DELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKASSKKT
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggtccgccgcgggctgctggggtggatttctcgggtagtgattctgctggtgctgctc
tgttgtgccatctctgtcctctacatgttagcctgcactccaaaaggcgaccaggagcag
ttgggactgccacgggccaatggacccacaggcaaagatggctaccaagcggtgctgcag
gagcgcgaggaacagcatcgtaactatgtgaatagccttaaacgacagatagctcagcta
aaggatgaactgcaggcacgcagtgagcagttccgcagtgggcaggaccaggccagcgat
gccaccagcctgcgctcaggctgggaccgtgagcccaaagcccaggccgatctgctggcc
ttcctgcgtggacaggtggacaaggccgaggtacatgccggtgtcaagctggccacggag
tatgctgctgtgccttttgatagcttcactctgcagaaagtataccagctggagactggc
ctgacccgccaccctgaggagaagccagtgaggaaagacaagcgcgatgagctggtagaa
gccatcgaatcggccctggagagtctaaacagccctgtggagagcagcccacaccagcgt
ccttacacagctgcagacttcatagaagggatttaccgaaccgaaagggataaaggcact
ttgtatgagctgaccttcaaaggggaccacaagcatgaattccagcgacttgtcctattt
cgaccttttggccccatcatgaaagtgaaaaaggaaaaactcaacctggccaacacgctt
atcaatgttattgtgcccctagcgaggagggtggacaagttccggcacttcatgcagaac
ttcagggagatgtgcatccaacaggatgggagagttcatctcaccgttgtttattttggg
aaagaagaaatgaatgaagtcaaaggaatacttgaaaacacttcaaaagctgccaatttc
agaaacttcaccttcatccaactgaatggagaattctcccggggaaagggactggatgtt
ggagcccgcttctggaagggaagtaacgtcctgctctttttctgtgatgtagacatctac
ttcacctcggagttcctcaacacttgtaggctgaacacacagccagggaagaaggtattt
tatccggttctgttcagtcagtataaccccggcgtaatctacggccatcacgatgcagtc
cctccgctaggacagcagctggtcataaagaaggaaacaggattttggagggactttgga
tttgggatgacatgtcagtaccggtcagacttcatcaacataggtggatttgacctggac
atcaaaggctggggtggtgaagatgtgcacctgtaccggaaatatctccatagcaacctc
atagtggtccgcacacctgtacggggacttttccacctgtggcatgaaaagcactgtatg
gatgaactgacccctgagcagtacaagatgtgcatgcaatcaaaggctatgaatgaagca
tcccatgggcagctggggatgcttgtcttccggcatgaaatagaggctcatcttcgcaaa
cagaagcagaaagccagcagtaaaaagacatga

DBGET integrated database retrieval system