KEGG   Mus musculus (house mouse): 234366
Entry
234366            CDS       T01002                                 
Symbol
Gatad2a, 1110066C11Rik, BC031407, C80248
Name
(RefSeq) GATA zinc finger domain containing 2A
  KO
K23194  transcriptional repressor p66
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    234366 (Gatad2a)
   03036 Chromosome and associated proteins [BR:mmu03036]
    234366 (Gatad2a)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    234366 (Gatad2a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Chromatin remodeling factors
   NuRD complex
    234366 (Gatad2a)
SSDB
Motif
Pfam: P66_CC GATA DUF2299
Other DBs
NCBI-GeneID: 234366
NCBI-ProteinID: NP_001106817
MGI: 2384585
Ensembl: ENSMUSG00000036180
UniProt: Q8CHY6
Position
8:complement(70359719..70450093)
AA seq 629 aa
MSEEACRTRSQKRTLEPDLTEDDVENKKMKMEKGSSELTVDGDSRVMPEPSAGSAQGLLR
TTEAMGTGSGEGLLGDGPVDMRTSHSDMKSEKRPPSPDVIVLSDSEQPSSPRVNGLTTVA
LKDTSTEALLKSSPEERERMIKQLKEELRLEEAKLVLLKKLRQSQIQKEATAQKPTASSG
STVTTPPPLVRGTQNIPAGKTSLQTSSTRIPGSIIPPPLVRGGQQVSAKLGPQASSQVVM
PPLVRGAQIHNIRQHSSTGPPPLLLAPRASVPSMQIQGQRIIQQGLIRVANVPNTSLLVN
IPQPTAASMKGTAVASAQANSTPTSVASVVASAESPASRQAAAKLALRKQLEKTLLEIPP
PKPPAPEMNFLPSAANNEFIYLVGLEEVVQNLLETQAGRISATAAAAVLSREPYMCVQCK
TDFTCRWREKGGAVMCENCMTSNQKKALKVEHTSRLKAAFVKALQQEQEMEQRLLQQGVG
TASIKAEPAAPHPTLKQVIKPRRKLAFRSGEARVWNNGSSLQASSQLSRGSATAPRGVLH
TFSQSPKLQNAASATALVSRTGRHSERVVGTGKGTASNWKKTPLSTGGTLAFVSPSLAVH
KTSSAVDRQREYLLDMIPPRSIPQSATWK
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgagtgaagaagcatgccgaacccgcagtcagaagcgcacccttgaacctgacctaacg
gaggatgatgtggagaacaagaaaatgaaaatggagaaagggtcatcagagctgacagtg
gacggagacagcagggtgatgccagagccgagtgcaggctcagcccaggggttgctgagg
acaacagaggccatgggcacaggatctggcgaggggctgttaggagacgggcctgtggac
atgcgcacttcacacagtgacatgaagtctgagaagagacctccctcgcctgatgtgatt
gtgctctctgacagtgagcagccatcgagcccaagggtgaatggcctgaccacagtagcc
ttgaaagacaccagcactgaggcgctcttgaaaagcagcccagaagaacgagagcggatg
atcaagcagctgaaggaggagctgaggctagaggaagcaaaactggtcttgttgaagaag
ctgcggcagagtcagatacagaaggaagccaccgcacagaagcctacagcttcctcaggg
agcactgtgaccacccctcccccactcgtgcggggtacccagaacattcctgctggcaag
acctcacttcagacctcctccactcgaatacccggcagcatcatcccaccaccactggtc
cgaggtgggcagcaggtgtctgccaaactgggaccacaggccagctctcaagtagtcatg
ccaccgcttgtcaggggggcccagattcacaacatcagacagcattcctctacggggcca
ccacccctcctcctggccccccgtgcctcagtgcccagcatgcagattcagggacagagg
atcatccagcagggacttatccgtgtcgccaatgtccccaacaccagtctgcttgtcaac
atccctcagcctactgcagcctccatgaaggggacagcagttgcttctgctcaggcaaat
tccactcccaccagtgtggcttctgtggttgcatctgctgagtctccagctagccgacag
gcggctgccaagctagcactgcgcaagcagctggagaagacactgctggagatcccccca
cccaagccccctgccccagagatgaacttcttgcccagtgctgccaataatgagtttatc
tacctggtcggcctggaggaggtggtgcagaacctgctggagacacaagcaggcaggatt
tctgccactgcagcagctgctgtgttatcccgggagccctacatgtgtgtgcagtgtaag
acagacttcacatgccgctggcgagagaagggtggagccgttatgtgtgagaactgcatg
acatccaaccaaaagaaggcactcaaggtggagcacaccagtcgcctgaaggccgccttt
gtgaaggctctacagcaagagcaggagatggagcagcgcctgctgcagcagggtgtgggt
actgccagcatcaaggctgagcctgcagctccacatcccacgctgaagcaggtcataaag
ccccgacgtaagttggcgttccgctcaggagaggcccgtgtctggaataacgggtcctca
ctacaggcttccagccagctgtcccgaggctcagccacagcacctcgtggtgttctgcac
actttcagccagtcacccaaactgcagaatgcagcctcagctacggccctggtaagcagg
actggcagacattccgagagagtcgtgggcaccggcaagggcaccgcctccaactggaaa
aagacgcctctgagcacaggtgggaccctcgccttcgtcagcccaagcttggcagtacac
aagacctcctcggctgtggatcgacagcgagaatacctcctggacatgattcctccacgc
tccatcccccaatcagccacatggaaatag

DBGET integrated database retrieval system