KEGG   Mus musculus (mouse): 234374Help
Entry
234374            CDS       T01002                                 

Gene name
Ddx49, R27090_2
Definition
(RefSeq) DEAD (Asp-Glu-Ala-Asp) box polypeptide 49
  KO
K14778  ATP-dependent RNA helicase DDX49/DBP8 [EC:3.6.4.13]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    234374 (Ddx49)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     234374 (Ddx49)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic Type
  90S particles
   Helicases
    234374 (Ddx49)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C ResIII AAA_22
Motif
Other DBs
NCBI-GeneID: 234374
NCBI-ProteinID: NP_001020093
MGI: 2136689
Ensembl: ENSMUSG00000057788
Vega: OTTMUSG00000027333
UniProt: Q4FZF3
Position
8; 8 B3.3
AA seq 480 aa AA seqDB search
MAGFAEIGLSSWLVEQCRQLGLKQPTPVQLGCIPAILEGRDCLGCAKTGSGKTAAFVLPI
LQKLSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRK
PHVVIATPGRLADHLRSSNTFNMKKIQFLVMDEADRLLEQGCTDFTTDLETILAAVPARR
QTLLFSATLTDTLKELQGLATNEPFFWEAQATVRTVEQLDQRYLLVPEKVKDAYLVHLVQ
TFQDQLEDCSIIIFTNTCKTCQILCMMLRKFNFPTVALHSMMKQKERFAALAKFKSSIYR
ILIATDVASRGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRQGQAITLVTQYDIHLL
HAIEEQIKQQLAELVVEEAEVLQILTQVNVVRRECEIKLEASHFDEKKEINKRKQMILEG
KDPDLEAKRKAELAKIKQQNRRFKEKVGQTLRRQKAGSTVRRSRPPRSRPQEPAQAEAQD
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcggggttcgctgagatcgggttgtcgtcgtggctggtagaacagtgtcgacagctg
gggttgaagcagcccacgccggtgcagctcgggtgcattccggccatcctggaaggtcgg
gactgcttgggctgtgcaaaaacaggaagtggcaagacagcagcctttgtgcttcccatc
ttgcagaagctgtctgaggacccttatggcatcttctgcttggttctgacacccaccaga
gagctggcctaccagatcgctgagcagttccgggtgctggggaagcctctgggtctgaag
gactgcatcattgttggtggaatggacatggtggctcaggcgctggagctctctcggaag
ccacatgtagtgattgccacccctgggcgcctggctgaccacctgcgcagttccaacact
ttcaacatgaagaaaatccaattcctggtgatggatgaggccgacaggctgctggagcag
ggttgcaccgacttcaccacagacctggagaccatcctggcagccgttccagcacgaagg
caaacgctgctgttcagtgccacgctgactgacacactcaaggagctgcagggcctggcc
accaacgagcccttcttttgggaggcacaggccacagtccgcacagtggagcagcttgat
cagcgctatttgttggtaccggagaaggtgaaggacgcctacctggttcacctagtccag
accttccaggaccagctggaggactgctccatcatcatcttcaccaatacctgcaagacc
tgccagatcctttgtatgatgcttcgaaagttcaacttccccacagtggcactgcactcc
atgatgaagcagaaagagcgctttgcggccctggccaaattcaagtccagcatctatcgg
attcttattgccactgacgtggcctcaaggggcctggacatccccaccgtgcaggtggtc
atcaaccacaacacccctgggcttcccaagatctacatccatcgggttggccgcacagcc
cgtgcagggaggcaggggcaagccatcacactggtgacgcagtatgatatccacctgttg
catgccatcgaggagcagatcaagcagcagctggcagagctggtggtggaggaggctgag
gttctacaaatcctcacgcaggtcaacgtagtgcgaagggagtgcgaaataaaactggag
gcttcgcattttgatgaaaagaaagagatcaacaagcggaaacagatgatcctggagggg
aaggacccagacctggaggccaaacgcaaagctgagctggccaagatcaagcaacaaaac
cgacgcttcaaggagaaagtggggcagacacttcggcggcagaaagcagggagcactgtc
cgacggtcgcgtcctcccagatctcggccccaagagccagcccaggctgaggctcaggac
tga

DBGET integrated database retrieval system