KEGG   Mus musculus (mouse): 234404
Entry
234404            CDS       T01002                                 

Symbol
Nxnl1, A930031O08Rik, RdCVF, Txnl6
Name
(RefSeq) nucleoredoxin-like 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Thioredoxin_8 TraF Thioredoxin Thioredoxin_2 Thioredoxin_7 AhpC-TSA Redoxin
Other DBs
NCBI-GeneID: 234404
NCBI-ProteinID: NP_663573
MGI: 1924446
Ensembl: ENSMUSG00000034829
Vega: OTTMUSG00000062163
UniProt: Q8VC33
Position
8; 8 B3.3
AA seq 217 aa
MASLFSGRILIRNNSDQDEVETEAELSRRLENRLVLLFFGAGACPQCQAFAPVLKDFFVR
LTDEFYVLRAAQLALVYVSQDPTEEQQDLFLRDMPEKWLFLPFHDELRRDLGRQFSVRQL
PAVVVLKPGGDVLTSDATEEIQRLGPACFANWQEAAELLDRSFLQPEDLDEPARRSITEP
LRRRKYRVDRDVGRERGRNGRDSGDPQGDAGTRAELW
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcatctctcttctctggacgcatcttgatcaggaacaacagcgaccaggatgaagtg
gagacagaggcagagctgagccgtaggttagagaatcgtctggtgttgctgttcttcggc
gccggcgcctgtccccagtgccaggcctttgccccagtcctcaaagacttcttcgtgcgg
ctcactgacgagttctacgtgctgcgggcagcacagctggccctggtctatgtgtcccag
gaccctacagaggagcaacaggacctcttcctcagggacatgcctgaaaaatggctcttc
ctgccgttccatgatgaactgaggagggacctcgggcgccagttctctgtccgtcaactg
ccagcggttgtggtacttaagcctggtggggacgtgctgacaagcgacgccacggaggag
atccagcgtctgggacccgcctgctttgccaactggcaggaggccgcagagctcctggac
cgcagcttcctgcaaccggaggatttggatgagcctgcgcggcgcagcatcaccgagcct
ctgcgccgtcgcaagtaccgagtagaccgggatgtcggccgggagcggggccgaaacggc
cgcgactctggtgacccccagggggacgcgggtacaagggcggagctctggtga

DBGET integrated database retrieval system