KEGG   Mus musculus (mouse): 234577Help
Entry
234577            CDS       T01002                                 

Gene name
Cpne2, 3322401K10Rik
Definition
(RefSeq) copine II
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Copine C2 vWA-TerF-like
Motif
Other DBs
NCBI-GeneID: 234577
NCBI-ProteinID: NP_705727
MGI: 2387578
Ensembl: ENSMUSG00000034361
Vega: OTTMUSG00000023458
UniProt: P59108
Position
8; 8 C5
AA seq 548 aa AA seqDB search
MAYIPDGGAPTAGAIPLGSQCCVCKVELSVSGQNLLDRDVTSKSDPFCVLFIEDNGRWME
FDRTETAVNNLNPAFSKKFVLDYHFEEVQKLKFALFDQDKSSAQLDEHDFLGQFSCSLGT
IVSSKKITRPLLLMNDKPAGKGVITIAAQELSDNRVITLSLAGRKLDKKDLFGKSDPFLE
FYKPGDDGKWMLVHRTEVIKYTLDPVWKPFTVPLVSLCDGDLEKPIQVMCYDYDSNGGHD
FIGEFQTSVLQMSEARDGVPLEIECINPKKQRKKKSYKNSGIIILRSCKIHRNYSFLDYI
LGGCQLMFTVGIDFTASNGNPLDPSSLHYINPMGTNEYLSAIWAVGQIIQDYDSDKMFPA
LGFGAQLPPDWKVSHEFAINFNPTNPFCSGVDGIAQAYSACLPHIRFYGPTNFSPIVNHV
ARFAAQATQQQTATQYFILLIITDGVISDMEETRHAVVQASKLPMSIIIVGVGNADFAAM
EFLDGDNRRLRSHTGEEAARDIVQFVPFREFRNAAKETLAKAVLAELPQQVVQYFKHKNL
PPTNSEPA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggcctacattccggatgggggtgctcctaccgctggggccatccccttgggttctcag
tgctgtgtgtgcaaagtggagctgtcagtgagtggccagaacctgctggaccgggatgtc
acctccaagtctgaccctttctgtgtcctctttatagaagacaatggcaggtggatggag
ttcgacagaacagaaacagccgtcaacaacctcaacccagccttctccaagaagttcgtg
ctggactaccacttcgaggaggtgcagaagctcaagttcgccctgtttgaccaggacaag
tccagtgcccagttggatgagcatgatttcctgggccagttctcctgcagcctgggcacg
attgtctccagcaagaagatcactaggcctctgctgctgatgaatgacaagccagcgggg
aagggcgtaatcacgattgcagcccaagagctgtcagacaaccgagtcatcacactgagc
ctggctggcaggaaactggataagaaggacctctttgggaagtcagacccttttcttgag
ttttacaagccaggagatgatggcaaatggatgctggtccataggaccgaggtgattaag
tacaccctggacccggtgtggaaaccattcactgtcccgttggtgtccttgtgtgatggc
gacctggagaagcccatccaggttatgtgctacgactatgacagtaatggaggccatgac
ttcatcggcgagttccagacctctgtgctgcagatgagcgaggctcgggatggtgtcccg
ctggagatagagtgcatcaaccccaagaagcagaggaagaagaaaagctacaagaactcg
ggcatcattattctgagatcatgcaagatacaccgaaactactcattcctggactacatt
ctgggaggctgccagctcatgttcaccgttggaatagacttcacagcctccaatgggaat
cccctcgacccttcttctctccattatatcaaccccatgggcaccaatgaatacttgtca
gccatctgggcagtgggacagatcattcaggactacgacagtgataagatgttccctgct
ctgggatttggggcccagttaccaccagactggaaggtgtcccatgagttcgctatcaac
ttcaaccccactaaccctttctgctcaggcgtggatggcatcgcccaggcgtactcagcc
tgtctgccccacattcgcttctatggccccacaaacttctccccgatcgtcaaccatgtg
gcccggtttgcagcccaggccacccagcagcagacagcaacgcagtacttcatcctcctc
atcatcaccgacggggtcatcagtgacatggaggagactcggcacgccgtggtgcaggcc
tccaagctgcccatgtccatcatcatcgtgggtgtgggcaatgctgactttgcagccatg
gagtttctagacggggacaaccgtcgactgcgctcacacacaggcgaggaggcggcccga
gatatcgtgcagttcgtgcccttccgagagttccgcaacgcagcaaaagaaacgctggct
aaagcggtgttggcggagctgcctcagcaagtagtgcagtatttcaagcataaaaacctg
ccccccaccaactcagagcctgcctga

DBGET integrated database retrieval system