KEGG   Mus musculus (house mouse): 234593
Entry
234593            CDS       T01002                                 
Symbol
Ndrg4, D8Bwg1337e, Ndr1-rs, Ndr4, SMAP-8
Name
(RefSeq) N-myc downstream regulated gene 4
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Ndr Abhydrolase_1 Endotoxin_N
Other DBs
NCBI-GeneID: 234593
NCBI-ProteinID: NP_001181935
MGI: 2384590
Ensembl: ENSMUSG00000036564
UniProt: Q8BTG7
Position
8:96403602..96441584
AA seq 352 aa
MPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTFFNFEDMQEIT
KHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVL
AKFALIFPDLVEGLVLMNIDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNNTE
LVQSYRQQISNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAE
EGVVECNSKLDPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYIAHLKDRRLSGG
AVPSASMTRLARSRTASLTSASSVDGSRPQPCAHSDSSEGMGQVNHTMEVSC
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgccggagtgctgggatggggaacatgacatcgagacgccttatggacttctgcatgtg
gtgatccggggctctcccaaagggaaccgcccagccatcctcacctaccatgatgtgggt
ctcaatcacaagctgtgcttcaacaccttcttcaactttgaggacatgcaggagatcacc
aaacactttgtggtgtgccacgtggatgcccctgggcagcaggtgggagcgtcacagttc
cctcaggggtaccagttcccctccatggagcagctggccgccatgctcccgagtgtggta
cagcactttgggtttaagtacgtgattggcattggagtgggagccggagcctacgtgctg
gccaagtttgcactcatcttccctgacctggtggaggggctggtgttgatgaacattgac
cccaacggcaaaggctggattgactgggctgccaccaagctctctggcttgaccagcact
ttaccagacactgtactctcccatctcttcagccaggaggagctggtgaacaacacggag
ctggtgcagagctaccggcagcagatctcaaacgtggtgaaccaggccaacctgcagctc
ttctggaacatgtacaacagccgcagagaccttgatattaaccgacctgggacggtgccc
aatgccaagacactccgctgcccagtgatgctggtagtcggagataatgcacctgctgag
gaaggggtggttgagtgtaactccaaactggacccaaccactacgaccttcctgaagatg
gcagattctggtggtcttcctcaggtgacacaaccagggaagctgactgaggccttcaag
tacttcctgcaaggcatgggctacattgcacacttgaaggaccgaaggctgagtggagga
gcagtgccctcagccagcatgacccgcctcgcacgctcacgtaccgcgtccctcaccagc
gccagttccgtggacggcagccgccctcagccctgcgcccactcagacagcagtgagggg
atgggccaggtcaaccacaccatggaggtgtcctgctga

DBGET integrated database retrieval system