KEGG   Mus musculus (mouse): 234664
Entry
234664            CDS       T01002                                 

Gene name
Nae1, 59kDa, Ap, Appbp1
Definition
(RefSeq) NEDD8 activating enzyme E1 subunit 1
  KO
K04532  NEDD8-activating enzyme E1 regulatory subunit
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    234664 (Nae1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    234664 (Nae1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   234664 (Nae1)
SSDB
Motif
Pfam: ThiF E1_4HB
Other DBs
NCBI-GeneID: 234664
NCBI-ProteinID: NP_659180
MGI: 2384561
Ensembl: ENSMUSG00000031878
Vega: OTTMUSG00000029165
UniProt: Q8VBW6 Q3UK27
Position
8; 8 D3
AA seq 534 aa
MAQPGKILKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTII
DGNLVSGEDAGNNFFLQKSSIGKNRAQAAMEFLQELNSDVSGSFVEESPENLLDNDPSFF
CRFTIVVATQLLESTLLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNAL
EDLRLDKPFPELREHLQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYNETNGRIPKSYKEK
EDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQ
TPTFWILARALKEFVAKEGQGNLPVRGTIPDMIADSNKYIKLQNVYREKAKKDAAAVGNH
VAKLLQSVGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTVNKDEIISSMDNPD
NEIVLYLMLRAVDRFHKQHGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDDYVH
EFCRYGAAEPHTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSGMSQTSATFQL
NT seq 1605 nt   +upstreamnt  +downstreamnt
atggcgcagccagggaagatactcaaggagcaaaagtacgaccggcagctgaggctgtgg
ggtgatcatggacaagaagctttggaatctgctcatgtttgcttaataaatgcaacggct
acaggaactgaaattcttaaaaacttggtgctgccaggtattggatcatttacaattatt
gatggaaatctggtcagcggagaagatgctggaaacaactttttccttcaaaaaagcagt
attggcaagaaccgagctcaagctgccatggaattcttacaagaactaaatagcgatgtc
tctggaagttttgtggaagagagtccagaaaaccttctagacaatgatccttcatttttc
tgtaggtttactattgtggttgcaactcagcttcttgaaagtacattgctgcgtttagca
gatgttctctggaattcccagatccctcttttgatctgtaggacatatggactagttggt
tatatgaggattattataaaagaacacccagtaatagaatctcatccagataatgcattg
gaggatctacgactagataagccatttcctgaactgagagaacatcttcagtcttatgac
ttggaccatatggaaaaaaaggaccatagccatactccatggattgtgatcatagctaaa
tatttagcacagtggtataatgaaacaaatggacggattcctaaaagttataaagaaaaa
gaggacttcagagatttgataagacaagggattttaaagaatgaaaatggagctccagaa
gacgaagagaattttgaagaagccatcaaaaatgtgaacacagcactaaatacaactcag
atcccaagcagtattgaagatatatttaatgatgatcgatgcataaatatcaccaaacag
acaccaactttttggattctagctcgtgccttaaaggaatttgtggccaaggagggtcaa
ggaaatttacctgtccgaggcacaattcctgatatgattgcagattcaaacaaatacata
aaactgcagaatgtttaccgagagaaagcaaagaaagatgctgctgctgtaggcaatcac
gttgccaaattgcttcagtctgttggccaggcaccagagtccatttcagagaaagaatta
aaattgctttgcagcaattctgcatttcttcgagtggtaagatgtcgatctttagctgaa
gagtatggcttggatacagtcaacaaagatgaaattatttctagcatggacaatccggat
aatgagatagtcctgtacctgatgttgcgggctgttgatcgatttcataaacagcatggc
agatacccaggagtatctaactatcaagttgaagaagatatagggaagttgaagtcctgt
cttactggcttccttcaggaatatgggctgtctgtaatggtgaaagacgattatgtccat
gaattttgccggtacggagctgctgagccacacaccattgctgcgttcctgggaggagct
gctgctcaagaagttatcaaaataatcaccaaacaattcgtaatttttaataatacttat
atttatagtggtatgtcacaaacttctgcaactttccagttgtag

DBGET integrated database retrieval system