KEGG   Mus musculus (house mouse): 234678
Entry
234678            CDS       T01002                                 
Symbol
Phaf1, D230025D16Rik, Lin10
Name
(RefSeq) phagosome assembly factor 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: PHAF1
Other DBs
NCBI-GeneID: 234678
NCBI-ProteinID: NP_663579
MGI: 2443049
Ensembl: ENSMUSG00000031889
UniProt: Q922R1
Position
8:105951779..105979685
AA seq 422 aa
MLDLEVVPERSLGNEQWEFTLGMPLAQAVAILQKHCRIIRNVQVLYSEQSPLSHDLILNL
TQDGITLLFDAFNQRLKVIEVCELTKVKLKYCGVHFNSQAIAPTIEQIDQSFGATHPGVY
NSTEQLFHLNFRGLSFSFQLDSWTEAPKYEPNFAHGLASLQIPHGATVKRMYIYSGNSLQ
DTKAPVMPLSCFLGNVYAESVDVLRDGTGPSGLRLRLLAAGCGPGVLADAKMRVFERAVY
FGDSCQDVLSMLGSPHKVFYKSEDKMKIHSPSPHKQVPSKCNDYFFNYFTLGVDILFDAN
THKVKKFVLHTNYPGHYNFNIYHRCEFKIPLAIKKENAGGQTEICTTYSKWDSIQELLGH
PVEKPVVLHRSSSPNNTNPFGSTFCFGLQRMIFEVMQNNHIASVTLYGPPRPGAHLRTAE
LP
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgctggacctggaggtggtgcctgaacgctctctggggaacgagcaatgggaattcact
ctgggaatgcctctggcgcaggcggtcgccattcttcagaagcactgtcgcatcatcaga
aacgtccaggttctctacagtgagcagtctcctctaagccatgacctcatccttaacctg
actcaggacgggatcacactactgtttgatgctttcaaccagagactcaaggtgattgaa
gtttgtgagttgacaaaagtaaagttaaagtattgtggagtgcattttaactctcaggcc
atcgctcctaccattgagcaaattgaccagtcttttggcgcaacccatcctggagtgtac
aactctactgagcagctcttccacctcaacttccgaggactgtctttctcttttcagtta
gactcgtggacggaggctcccaagtatgagcccaattttgcccatggtctagcttctctt
cagataccccatggagcaactgtaaaacgaatgtacatctatagtgggaacagcctccag
gataccaaggctcctgtgatgcccttgagctgtttcctggggaatgtatatgctgaaagt
gtagacgttcttcgagatggaactggaccctcagggttgcgacttcgcttgctcgctgca
ggttgtggacctggagtgttagcagatgccaaaatgagagtatttgagcgtgcggtgtat
tttggtgattcttgccaagatgttcttagcatgcttggctctccacacaaagtcttctat
aaatctgaagacaagatgaaaattcactctccttcccctcataaacaagttccgtccaag
tgcaacgactacttttttaactattttactctcggagtggacatcctgtttgatgcaaat
acacacaaagtgaagaagtttgtcctgcataccaattaccctgggcattataattttaac
atttaccaccgctgtgagttcaagatcccactggccataaagaaagaaaatgcaggtggt
cagactgaaatatgcacaacctacagcaagtgggacagcatccaggagcttctgggccat
cctgtggagaagcctgttgtcttgcacaggtcctcatccccaaataacaccaatccgttt
ggctccacattctgctttggtcttcagcggatgatctttgaggtcatgcagaacaaccac
attgcctcagtgaccctgtatggcccccccaggcctggtgcccacctgagaacagcagag
ctgccctaa

DBGET integrated database retrieval system