KEGG   Mus musculus (mouse): 234678Help
Entry
234678            CDS       T01002                                 

Gene name
D230025D16Rik, BC006874, Lin10
Definition
(RefSeq) RIKEN cDNA D230025D16 gene
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0183
Motif
Other DBs
NCBI-GeneID: 234678
NCBI-ProteinID: NP_663579
MGI: 2443049
Ensembl: ENSMUSG00000031889
Vega: OTTMUSG00000031385
UniProt: Q922R1
Position
8; 8 D3
AA seq 422 aa AA seqDB search
MLDLEVVPERSLGNEQWEFTLGMPLAQAVAILQKHCRIIRNVQVLYSEQSPLSHDLILNL
TQDGITLLFDAFNQRLKVIEVCELTKVKLKYCGVHFNSQAIAPTIEQIDQSFGATHPGVY
NSTEQLFHLNFRGLSFSFQLDSWTEAPKYEPNFAHGLASLQIPHGATVKRMYIYSGNSLQ
DTKAPVMPLSCFLGNVYAESVDVLRDGTGPSGLRLRLLAAGCGPGVLADAKMRVFERAVY
FGDSCQDVLSMLGSPHKVFYKSEDKMKIHSPSPHKQVPSKCNDYFFNYFTLGVDILFDAN
THKVKKFVLHTNYPGHYNFNIYHRCEFKIPLAIKKENAGGQTEICTTYSKWDSIQELLGH
PVEKPVVLHRSSSPNNTNPFGSTFCFGLQRMIFEVMQNNHIASVTLYGPPRPGAHLRTAE
LP
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgctggacctggaggtggtgcctgaacgctctctggggaacgagcaatgggaattcact
ctgggaatgcctctggcgcaggcggtcgccattcttcagaagcactgtcgcatcatcaga
aacgtccaggttctctacagtgagcagtctcctctaagccatgacctcatccttaacctg
actcaggacgggatcacactactgtttgatgctttcaaccagagactcaaggtgattgaa
gtttgtgagttgacaaaagtaaagttaaagtattgtggagtgcattttaactctcaggcc
atcgctcctaccattgagcaaattgaccagtcttttggcgcaacccatcctggagtgtac
aactctactgagcagctcttccacctcaacttccgaggactgtctttctcttttcagtta
gactcgtggacggaggctcccaagtatgagcccaattttgcccatggtctagcttctctt
cagataccccatggagcaactgtaaaacgaatgtacatctatagtgggaacagcctccag
gataccaaggctcctgtgatgcccttgagctgtttcctggggaatgtatatgctgaaagt
gtagacgttcttcgagatggaactggaccctcagggttgcgacttcgcttgctcgctgca
ggttgtggacctggagtgttagcagatgccaaaatgagagtatttgagcgtgcggtgtat
tttggtgattcttgccaagatgttcttagcatgcttggctctccacacaaagtcttctat
aaatctgaagacaagatgaaaattcactctccttcccctcataaacaagttccgtccaag
tgcaacgactacttttttaactattttactctcggagtggacatcctgtttgatgcaaat
acacacaaagtgaagaagtttgtcctgcataccaattaccctgggcattataattttaac
atttaccaccgctgtgagttcaagatcccactggccataaagaaagaaaatgcaggtggt
cagactgaaatatgcacaacctacagcaagtgggacagcatccaggagcttctgggccat
cctgtggagaagcctgttgtcttgcacaggtcctcatccccaaataacaccaatccgttt
ggctccacattctgctttggtcttcagcggatgatctttgaggtcatgcagaacaaccac
attgcctcagtgaccctgtatggcccccccaggcctggtgcccacctgagaacagcagag
ctgccctaa

DBGET integrated database retrieval system