KEGG   Mus musculus (mouse): 234723
Entry
234723            CDS       T01002                                 

Symbol
Txnl4b, AI595343, D530025J19Rik, DLP, Dim2
Name
(RefSeq) thioredoxin-like 4B
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DIM1 Thioredoxin
Other DBs
NCBI-GeneID: 234723
NCBI-ProteinID: NP_783577
MGI: 2443724
Ensembl: ENSMUSG00000031723
Vega: OTTMUSG00000031603
UniProt: Q8BUH1
Position
8; 8 D3
AA seq 149 aa
MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSADLSKMAAIYL
VDVDHTPVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIY
RGAMRGKLIVQSPIDPKNVPKYDLLYQDI
NT seq 450 nt   +upstreamnt  +downstreamnt
atgagcttcctcttgcccaaactgaccagcaagaaagaagtagaccaggcgatcaaaagc
actgcggagaaggtgttggttctcaggtttgggagggacgaggaccccgtctgtctgcag
ctggatgatattctctcaaaaacttcagccgacctgagtaaaatggctgctatttacctg
gtggacgtggaccacacgccggtttacacacagtattttgacatcagttacattccctct
accgtatttttcttcaatgggcagcacatgaaggtggattatgggtctccggatcacact
aaattcgtaggaagcttcaaaaccaaacaagacttcatagatttgattgaagtcatctac
cggggagcgatgaggggaaaacttattgtccagagtcctattgatcccaagaacgtgccc
aaatatgacctcctctatcaagacatttaa

DBGET integrated database retrieval system