KEGG   Mus musculus (mouse): 234724
Entry
234724            CDS       T01002                                 

Symbol
Tat
Name
(RefSeq) tyrosine aminotransferase
  KO
K00815  tyrosine aminotransferase [EC:2.6.1.5]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00130  Ubiquinone and other terpenoid-quinone biosynthesis
mmu00270  Cysteine and methionine metabolism
mmu00350  Tyrosine metabolism
mmu00360  Phenylalanine metabolism
mmu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00034  Methionine salvage pathway
mmu_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    234724 (Tat)
   00350 Tyrosine metabolism
    234724 (Tat)
   00360 Phenylalanine metabolism
    234724 (Tat)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    234724 (Tat)
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    234724 (Tat)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    234724 (Tat)
Enzymes [BR:mmu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.5  tyrosine transaminase
     234724 (Tat)
Amino acid related enzymes [BR:mmu01007]
 Aminotransferase (transaminase)
  Class I
   234724 (Tat)
SSDB
Motif
Pfam: Aminotran_1_2 TAT_ubiq Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Asp_aminotransf
Other DBs
NCBI-GeneID: 234724
NCBI-ProteinID: NP_666326
MGI: 98487
Ensembl: ENSMUSG00000001670
Vega: OTTMUSG00000026257
UniProt: Q8QZR1
Structure
Position
8:110712710..110726436
AA seq 454 aa
MDSYVIQTNVNDSLPSVLDVRVNIGGRSSVQGRAKGRKARWNVRPSDMSNKTFNPIRAIV
DNMKVKPNPNKTVISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGYLSSRE
EVASYYHCPEAPLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMG
IEVKLYNLLPEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQ
CVPILADEIYGDMVFSDCKYEPMATLSTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDI
FGNEIRDGLVKLSQRILGPCTIVQGALKSILQRTPQEFYQDTLSFLKSNADLCYGALSAI
PGLQPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLIAEQSVHCLPATCFEYPNFFRVVI
TVPEVMMLEACSRIQEFCEQHYHCAEGSQEECDK
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggactcctacgtaatccagacgaatgtcaatgacagcctaccttcagtgctggatgtt
cgcgtcaatattggcgggagaagctcggtgcaagggagagcgaagggcaggaaggccagg
tggaatgtgaggccctctgacatgtccaataaaaccttcaatcccatccgagccattgtg
gacaacatgaaggtgaagccgaatccgaacaaaaccgtgatctctctgtcaattggggac
cctactgtgtttgggaacctgcccacagaccctgaagtgacccaagccatgaaggatgcc
ctggactccgggaagtacaatggctatgccccatctatcggctacctatccagtcgggag
gaggtcgcttcctattaccactgtcctgaggctcctctggaagctaaggatgtcattctg
acgagtggctgcagtcaggccattgagctgtgtctagccgtgttggccaatcctggacag
aacatcctcattccgaggcccgggttttccctctacaggacattggctgagtctatgggg
attgaggtcaagctctacaatctattgcctgagaagtcttgggaaattgatctaaaacaa
ctggaatctctgatcgacgaaaaaacagcttgtctcgtggtcaacaacccgtccaatccc
tgtggctctgtgttcagtaagcggcaccttcagaagattttggcagtggctgaaaggcaa
tgcgtccccatcttagccgatgagatctatggtgacatggtgttttcagattgcaaatat
gaaccaatggccaccctcagcaccaatgtccccatcctgtcctgtggtgggctggccaag
cgctggctggttcctggctggaggctgggctggatccttatccatgatcgaagagacatt
tttggcaatgagattcgggacgggctggtgaagctgagtcagcggatcctgggcccgtgc
accatcgtccaaggtgccctgaagagcatccttcagcgcacccctcaggagttctaccag
gacactttaagcttccttaagtccaatgcggacctctgctatggggcgttgtctgccatt
cctggactccagccagtccgcccatctggagccatgtaccttatggtgggaattgagatg
gagcacttcccagaatttgagaatgacgtggaattcacagagcggttaattgcggagcag
tctgtccactgcctcccagccacgtgcttcgagtacccaaatttcttccgggttgtcatc
acagtccccgaggtgatgatgctggaggcttgtagccggatccaggagttctgtgaacag
cactaccactgtgctgaaggcagccaggaggagtgtgacaaatag

DBGET integrated database retrieval system