KEGG   Mus musculus (mouse): 234729
Entry
234729            CDS       T01002                                 

Symbol
Vac14, AA959718, BC032215, D8Wsu151e, Tax1bp2, Trx, ingls
Name
(RefSeq) Vac14 homolog (S. cerevisiae)
  KO
K15305  vacuole morphology and inheritance protein 14
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    234729 (Vac14)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    234729 (Vac14)
SSDB
Motif
Pfam: Vac14_Fig4_bd Vac14_Fab1_bd HEAT HEAT_EZ TAF6_C
Other DBs
NCBI-GeneID: 234729
NCBI-ProteinID: NP_666328
MGI: 2157980
Ensembl: ENSMUSG00000010936
Vega: OTTMUSG00000061893
UniProt: Q80WQ2
Position
8 E1; 8 57.59 cM
AA seq 782 aa
MNPEKDFAPLTPNIVRALNDKLYEKRKVAALEIEKLVRDFVAQNNTMQIKHVIQTLSQEF
ALSQHPHSRKGGLIGLAACSIALGKDSGLYLKELIEPVLTCFNDADSRLRYYACEALYNI
VKVARGAVLPHFNVLFDGLSKLAADPDPNVKSGSELLDRLLKDIVTESSKFDLVSFIPLL
RERIYSNNQYARQFIISWILVLVSVPDINLLDYLPEILDGLFQILGDNGKEIRKMCEVVL
GEFLKEIKKNPSSVKFAEMANILVIHCQTTDDLIQLTAMCWMREFIQLAGRVMLPYSSGI
LTAVLPCLAYDDRKKSIKEVANVCNQSLMKLVTPEDDEPDEPKSVAQKQTEPNPEDSLPK
QEGTASGGPGSCDSSFGSGINVFTSANTDRAPVTLHLDGIVQVLNCHLSDTTIGMMTRIA
VLKWLYHLYIKTPRKMFRHTDSLFPILLQTLSDESDEVVLKDLEVLAEIASSPAGQTDDP
GAPDGPDLRVNHSELQVPTSGRANLLNPPSTKGLEGSPSTPTMNSYFYKFMINLLQTFSS
ERKLLEARGPFIIRQLCLLLNAENIFHSMADILLREEDLKFASTMVHTLNTILLTSTELF
QLRNQLKDLQTPESQNLFCCLYRSWCHNPVTTVSLCFLTQNYRHAYDLIQKFGDLEVTVD
FLTEVDKLVQLIECPIFTYLRLQLLDVKNNPYLIKALYGLLMLLPQSSAFQLLSHRLQCV
PNPELLQTEDCLKAAPKSQKGDSPSIDYTELLQHFEKVQKQHLEVRHQRSGRGDHLDRRV
IL
NT seq 2349 nt   +upstreamnt  +downstreamnt
atgaacccagagaaggattttgcgccgctcactcccaacatcgtaagggccctgaatgat
aaactctacgaaaagcggaaggttgcagcgctggagatcgagaagctggtgcgggacttt
gtggcccagaacaacaccatgcaaatcaagcacgtgatccagaccctgtctcaggagttt
gccctgtcccagcacccccacagccggaaagggggcctcatcggtctggcagcctgctct
attgccctaggcaaggactcagggctctacctgaaggagctgatagagccagtgctgacc
tgctttaatgacgcagacagcaggctgcgctactacgcttgtgaggccctctacaatatc
gtcaaagtggcccgaggtgccgtgctgccgcacttcaatgttctcttcgatggactgagt
aagttggctgctgacccagaccccaatgtgaaaagtggatctgagctcctggaccgcctc
ttaaaggacattgtgacagaaagcagcaagtttgacctggtgagcttcatcccccttttg
cgggagaggatttactccaacaaccaatacgcccgacagttcatcatctcctggatcctg
gttctggtgtcggtgccagacattaacctgctggattacctgccagagatcctagatggg
ctcttccagatcctgggtgacaatggcaaggagattcggaaaatgtgtgaggtggttctt
ggagagttcttgaaagaaattaagaagaacccatccagtgtgaagtttgctgagatggcc
aacatcctggtgatccactgccagaccacagatgacctgattcagctgacggctatgtgc
tggatgcgggaattcatccagctggcgggccgggtaatgctgccctattcctctgggatc
ctgactgctgtcctgccatgcttggcctatgatgaccgcaagaaaagtatcaaggaggtg
gccaatgtgtgtaaccagagcttgatgaagctggtcacccctgaggatgatgaacccgat
gagccaaagtcagtagcacagaagcagaccgaacccaaccctgaggattccctgccaaag
caggaggggacagccagtggaggtccaggttcctgtgactccagctttggaagtggcatc
aatgtcttcacctcagccaacactgatagggctccagtgaccctgcacctggacgggatt
gttcaagtcctgaactgtcaccttagtgacacaaccattgggatgatgaccaggattgct
gttctgaagtggctctaccatctctacatcaaaactcctcgaaagatgttccggcacaca
gacagcctcttccccatcttacttcagacattatctgacgaatctgatgaggttgtcttg
aaggatctggaagtgttggcagaaattgcttcctcccctgcaggccagacggatgaccca
ggtgcacctgatggccctgacctccgagtcaaccactcggagcttcaggtgcccacctcc
ggcagagccaacctactaaaccctcccagtaccaaaggcttagaaggctccccctccact
cccaccatgaactcctacttttacaagttcatgatcaaccttctacagacgttcagcagt
gaacggaagctcctggaggccagaggcccgttcatcatcaggcagctctgcctcctgctg
aatgcagagaacatcttccattcaatggcagacatcctgcttcgggaggaggacctcaag
ttcgcgtccaccatggtgcacaccctcaacaccatcctgctcacctccaccgagctcttc
cagctgaggaaccagctcaaggacctgcagaccccggaaagccagaacctcttctgctgc
ctgtaccgctcctggtgccacaacccagtcaccaccgtgtccctctgcttcctcacccag
aactaccgccacgcctatgacctcatccagaagtttggggacctggaagtcacagtggat
ttcctcacagaggtggacaaactcgtgcagctaattgagtgccccatctttacatatcta
cgcctgcaactgctggacgtgaagaacaacccatacctgatcaaggccctgtacggcctg
ctcatgctgttgccccagagcagtgccttccagctgctctctcaccggctccagtgtgtg
cccaaccctgagctgctgcagactgaagactgtctgaaagcggcccccaagtcccagaaa
ggtgactcccccagcatcgactacacagagctgctgcagcactttgaaaaagtccagaaa
cagcacctggaagtaagacaccagcgcagtgggcgaggggatcacctggaccgcagagtt
atcctctga

DBGET integrated database retrieval system