KEGG   Mus musculus (mouse): 234733Help
Entry
234733            CDS       T01002                                 

Gene name
Ddx19b, 2810457M08Rik, 4921519L13Rik, AW260119
Definition
(RefSeq) DEAD (Asp-Glu-Ala-Asp) box polypeptide 19b
  KO
K18655  ATP-dependent RNA helicase DDX19/DBP5 [EC:3.6.4.13]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:mmu03019]
    234733 (Ddx19b)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     234733 (Ddx19b)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     234733 (Ddx19b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C
Motif
Other DBs
NCBI-GeneID: 234733
NCBI-ProteinID: NP_001177715
MGI: 2148251
Ensembl: ENSMUSG00000033658
Vega: OTTMUSG00000031896
UniProt: Q8R3C7 Q8BZY3
Position
8; 8 E1
AA seq 494 aa AA seqDB search
MLRRDGRSCWPGRGRARARAQAQARNPLSLPLTGLSNLHLKEEKIKPDANGAVVKTNANT
EKTEEDEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPSSPLYSVKSFEELRLKPQLLQ
GVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAVLSQVEPANKFAQC
LCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKVSEQIVIGTPGTVLDWC
SKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFA
QKVVPDPNIIKLKREEETLDTIKQYYVLCNNREEKFQALCNLYGAITIAQAMIFCHTRKT
ASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVV
INFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIER
LDTDDLDEIEKIAN
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgccgcgatggccggagctgctggccgggtcgaggtcgagcccgagcccgagcc
caagcccaagctcggaatccactttccctgcccctgactggtttgagcaacttgcatctt
aaggaggagaaaatcaaaccagatgccaatggtgctgttgttaagaccaatgcaaacaca
gagaagacagaggaagatgagaaagaggacagagctgctcagtctttactcaacaagctg
atcagaagcaatcttgtggataacaccaaccaagtggaagtcctgcagagggacccaagc
tccccgctctactcagtgaagtccttcgaagagcttcgcctgaaaccacagcttctccag
ggagtctatgctatgggtttcaaccgcccttccaaaatacaggaaaatgcattgcctttg
atgcttgctgaacccccacagaacttaattgcccagtctcagtctggtacgggtaaaaca
gctgcctttgttttggctgtgctcagccaagtagagcctgcaaacaagtttgcccagtgt
ctctgcctctctccaacctatgagcttgctcttcaaacaggaaaagtgattgagcagatg
ggcaagttttaccctgaactgaagctagcttatgctgttcgaggcaacaaattggagagg
ggtcagaaggtgagtgagcagattgtcattggcacccccgggaccgtcttggactggtgc
tccaagctgaagttcattgaccccaagaagatcaaggtgtttgttctggacgaggctgat
gtgatgatagcgactcagggccaccaagaccagagcatccgcatccagaggatgctgccc
agaaactgccagatgctgcttttctcggccacctttgaagactcggtgtggaagtttgcc
cagaaggtggtcccagaccccaacatcatcaagctgaagcgtgaggaggagactctggac
accatcaaacagtactacgtcctctgcaataacagagaggagaagttccaggccctgtgc
aatctgtatggggccatcaccatcgcccaagccatgatcttctgccatacccgcaaaaca
gctagctggctggcagcagagctctcaaaagagggccaccaggtggccctgctgagtgga
gagatgatggtggagcagagggctgcggtgatcgagcgcttccgagaaggcaaagagaag
gttctggtgaccaccaacgtgtgtgcccgtggtatcgatgttgaacaggtgtctgtcgtc
atcaattttgacctccctgtggacaaggacgggaacccagacaatgagacctacctgcac
cgcattgggcgcactggccgctttggcaagaggggtctggcggtcaacatggtggacagc
aagcacagcatgaatatcctcaacaggatccaggagcattttaataagaagatagaaaga
ctggacacagatgatttggacgagattgagaaaatcgccaactga

DBGET integrated database retrieval system