KEGG   Mus musculus (house mouse): 234733
Entry
234733            CDS       T01002                                 
Symbol
Ddx19b, 2810457M08Rik, 4921519L13Rik
Name
(RefSeq) DEAD box helicase 19b
  KO
K18655  ATP-dependent RNA helicase DDX19/DBP5 [EC:3.6.4.13]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
mmu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    234733 (Ddx19b)
   03015 mRNA surveillance pathway
    234733 (Ddx19b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    234733 (Ddx19b)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     234733 (Ddx19b)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     234733 (Ddx19b)
SSDB
Motif
Pfam: DEAD Helicase_C
Other DBs
NCBI-GeneID: 234733
NCBI-ProteinID: NP_001177715
MGI: 2148251
Ensembl: ENSMUSG00000033658
UniProt: Q8R3C7 Q8BZY3
Position
8:complement(111729818..111758383)
AA seq 494 aa
MLRRDGRSCWPGRGRARARAQAQARNPLSLPLTGLSNLHLKEEKIKPDANGAVVKTNANT
EKTEEDEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPSSPLYSVKSFEELRLKPQLLQ
GVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAVLSQVEPANKFAQC
LCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKVSEQIVIGTPGTVLDWC
SKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFA
QKVVPDPNIIKLKREEETLDTIKQYYVLCNNREEKFQALCNLYGAITIAQAMIFCHTRKT
ASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVV
INFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIER
LDTDDLDEIEKIAN
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgttgcgccgcgatggccggagctgctggccgggtcgaggtcgagcccgagcccgagcc
caagcccaagctcggaatccactttccctgcccctgactggtttgagcaacttgcatctt
aaggaggagaaaatcaaaccagatgccaatggtgctgttgttaagaccaatgcaaacaca
gagaagacagaggaagatgagaaagaggacagagctgctcagtctttactcaacaagctg
atcagaagcaatcttgtggataacaccaaccaagtggaagtcctgcagagggacccaagc
tccccgctctactcagtgaagtccttcgaagagcttcgcctgaaaccacagcttctccag
ggagtctatgctatgggtttcaaccgcccttccaaaatacaggaaaatgcattgcctttg
atgcttgctgaacccccacagaacttaattgcccagtctcagtctggtacgggtaaaaca
gctgcctttgttttggctgtgctcagccaagtagagcctgcaaacaagtttgcccagtgt
ctctgcctctctccaacctatgagcttgctcttcaaacaggaaaagtgattgagcagatg
ggcaagttttaccctgaactgaagctagcttatgctgttcgaggcaacaaattggagagg
ggtcagaaggtgagtgagcagattgtcattggcacccccgggaccgtcttggactggtgc
tccaagctgaagttcattgaccccaagaagatcaaggtgtttgttctggacgaggctgat
gtgatgatagcgactcagggccaccaagaccagagcatccgcatccagaggatgctgccc
agaaactgccagatgctgcttttctcggccacctttgaagactcggtgtggaagtttgcc
cagaaggtggtcccagaccccaacatcatcaagctgaagcgtgaggaggagactctggac
accatcaaacagtactacgtcctctgcaataacagagaggagaagttccaggccctgtgc
aatctgtatggggccatcaccatcgcccaagccatgatcttctgccatacccgcaaaaca
gctagctggctggcagcagagctctcaaaagagggccaccaggtggccctgctgagtgga
gagatgatggtggagcagagggctgcggtgatcgagcgcttccgagaaggcaaagagaag
gttctggtgaccaccaacgtgtgtgcccgtggtatcgatgttgaacaggtgtctgtcgtc
atcaattttgacctccctgtggacaaggacgggaacccagacaatgagacctacctgcac
cgcattgggcgcactggccgctttggcaagaggggtctggcggtcaacatggtggacagc
aagcacagcatgaatatcctcaacaggatccaggagcattttaataagaagatagaaaga
ctggacacagatgatttggacgagattgagaaaatcgccaactga

DBGET integrated database retrieval system