KEGG   Mus musculus (mouse): 234734Help
Entry
234734            CDS       T01002                                 

Gene name
Aars, AI316495, C76919, sti
Definition
(RefSeq) alanyl-tRNA synthetase
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00970  Aminoacyl-tRNA biosynthesis
Module
mmu_M00359  Aminoacyl-tRNA biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    234734 (Aars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    234734 (Aars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    234734 (Aars)
Enzymes [BR:mmu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     234734 (Aars)
Amino acid related enzymes [BR:mmu01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   234734 (Aars)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    234734 (Aars)
 Prokaryotic Type
    234734 (Aars)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_2c DHHA1 tRNA_SAD Swi5 BST2
Motif
Other DBs
NCBI-GeneID: 234734
NCBI-ProteinID: NP_666329
MGI: 2384560
Ensembl: ENSMUSG00000031960
Vega: OTTMUSG00000031898
UniProt: Q8BGQ7 Q3UD67
Position
8; 8 E1
AA seq 968 aa AA seqDB search
MDATLTAREIRERFINFFRRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPS
HPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALE
LLTQEFGIPVERLYVTYFGGDEAAGLEPDLECRQIWQNLGLDEARILPGNMKDNFWEMGD
TGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNRESDGVLKPLPKKSIDT
GMGLERLVSVLQNKMSNYDTDLFMPYFEAIQKGTGARPYTGKVGAEDADGIDMAYRVLAD
HARTITVALADGGRPDNTGRGYVLRRILRRAVRYSHEKLNASRGFFATLVDVVVQSLGDA
FPELKKDPEMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDCKTIPGDTAWLLYDTYGF
PVDLTGLIAEEKGLVVDMNGFEEERRLAQLKSQGKGAGDEDLIMLDIYAIEELRAKGLEA
TDDSPKYNYQSDSSGSYVFECTVATVLALRREKMFVDEVVTGQECGVVLDKTCFYAEQGG
QIYDEGYLVKVDDSSEDKTEFTVKNAQVRGGYVLHIGTIYGNLKVGDQVRLFIDEPRRRP
VMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIVNGMI
EAAKPVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPCGPAGSLTSV
EFCGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKSETLKKSLSAMEAK
VKAQTAPNKDVQREIADLGEALATAVIPQWQKDEQRETLKSLKKVMDDLDRASKADVQKR
VLEKTKQLIDSNPNQPLVILEMESGASAKALNEALKLFKTHSPQTSAMLFTVDNEAGKIT
CLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDMSAQATGKNVGCLQEALQLATSFAQ
LRLGDVKN
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggatgccactttaacagcacgagagatccgagagcggtttataaatttcttcagacga
aatgagcacacctatgtccactcttccgccaccatccctctggatgaccccactctgctc
ttcgccaacgctggcatgaaccagttcaaacccatcttcctaaacacaatcgacccatct
caccctatggcgaagctgagcagagctgccaatacccagaaatgcatccgagctgggggc
aagcacaacgacctggatgacgtgggcaaggatgtctaccaccacactttctttgagatg
ctgggctcctggtcttttggggactatttcaaggaattggcatgtaagatggccctggaa
cttcttacccaggagtttggtattccagttgaaagactctatgtcacttactttggtggt
gatgaggcggccggcctagagccagatctggagtgcagacagatttggcaaaatttagga
ctggatgaagccagaatcctccctggcaacatgaaggacaacttctgggagatgggtgac
acaggcccctgtggtccctgcagcgagatccactatgaccgcattggtggcagggacgcc
gcacaccttgtcaaccaggatgaccccaatgtgctggagatctggaacctcgtgttcatc
cagtataacagggagtcggatggtgttctgaaacctcttcccaagaaaagcatcgacaca
gggatgggcctagagaggctggtgtctgtgctgcagaacaagatgtccaactacgacacc
gaccttttcatgccttacttcgaagccattcagaagggcaccggcgcccggccgtatact
gggaaggttggtgctgaggatgcagacggaatcgacatggcctaccgggttctggctgac
cacgcccggaccatcactgtggcgctggctgatggcggccggcctgacaacacaggacgg
gggtacgtgctgagacggatccttcgccgagctgttcggtattcccatgagaaactgaat
gccagcaggggtttcttcgctacattggttgatgttgtcgttcaatccctgggagacgca
tttcctgagctgaagaaggacccagagatggtgaaggacatcattaatgaagaagaggtg
cagtttctcaagactctcagccgagggcggcgcatcctggaccgaaaaattcagagctta
ggagactgcaaaaccatcccaggtgacaccgcttggctcctctatgatacttatggattc
ccagtggacctcactggattgattgctgaagagaagggcctggtggtagatatgaatggc
tttgaggaagagaggagactggcccagctgaagtcacagggcaagggagcaggggacgaa
gacctcatcatgctggacatttacgctattgaagagctccgggcaaagggtttggaggcc
acagatgattctccaaagtataactaccaatcagactccagtggtagctacgtgtttgag
tgtacagtggctaccgtgcttgctctgcgtcgggaaaagatgtttgtggacgaggtggtc
actggccaggagtgtggagtggtgctggacaagacctgtttctatgcggagcaaggaggg
cagatctacgatgaaggctacttggtgaaggtcgacgacagcagtgaggacaaaaccgag
tttacagtgaagaacgctcaggtccgaggcgggtacgtgctgcacataggaacgatatat
ggtaacctgaaagtgggggatcaagtccggctgtttattgatgagccccggcggagaccc
gtcatgagcaaccacacagctacacacatcctcaacttcgccttgcgctcggtgcttggg
gaagcggaccagaaaggttcactggttgctcctgaccgccttcggtttgacttcactgcc
aagggagccatgtccacccagcaaatcaagaaggctgaagagattgtcaatggcatgatt
gaggcagctaagcctgtctacacccaggattgtcccctggcagcagcaaaagccatccag
ggccttcgagctgtgtttgatgagacctatcctgaccccgttcgagtcgtctccattggg
gtccccgtgtcagagctgctggatgacccgtgtgggcctgctggctcccttacttctgtt
gagttctgtggaggaacacatctacggaattctagccacgcaggcgcttttgtgatagtg
acagaagaagctattgccaagggtatccggaggattgttgctgtcacaggtgctgaagcc
cagaaggctctcaggaagtcagaaaccttgaagaaatctctctctgccatggaggccaaa
gtgaaggcccagactgcacccaacaaggacgtgcagagggaaattgctgacctcggtgag
gccctggccactgcagtcatcccccagtggcagaaagatgaacaacgagagactctgaag
tccctgaagaaagtcatggatgacctagaccgggccagcaaagccgatgtgcagaagcga
gtgttagagaagacaaagcagctgattgacagcaaccccaaccagccgctggtcatcctg
gagatggagagtggagcatcggccaaggccctgaatgaagcgttgaagcttttcaagacg
cattctcctcagacatctgccatgctgttcacggtggacaatgaggctggcaagatcacg
tgcttgtgccaggttccccagaatgcagccaaccggggactgaaagccagcgagtgggtc
cagcaggtttcaggcctgatggatggtaaaggcggtggcaaggacatgtccgcccaggcc
acaggcaagaacgtgggctgccttcaggaagcactgcagctggctacctcctttgcccag
ctccgtctgggagatgtgaagaactga

DBGET integrated database retrieval system