KEGG   Mus musculus (mouse): 234796
Entry
234796            CDS       T01002                                 

Gene name
Klhl36
Definition
(RefSeq) kelch-like 36
  KO
K13958  kelch-like protein 36
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    234796 (Klhl36)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     234796 (Klhl36)
SSDB
Motif
Pfam: Kelch_1 Kelch_6 BTB Kelch_2 Kelch_4 BACK Kelch_3 Kelch_5
Other DBs
NCBI-GeneID: 234796
NCBI-ProteinID: NP_666331
MGI: 2385305
Ensembl: ENSMUSG00000031828
Vega: OTTMUSG00000061657
UniProt: Q8R124
Position
8; 8 E1
AA seq 613 aa
MEASKQMRVSRPYKISESSKVYHWPDHSTAVLQRLNEQRLHGLFCDVVLVVEEQQVPAHR
NLLAVCSDYFNSMFTLGMREAFQKEVELVGTSYVGLKAVVDFLYSSELELDGSNIDYILE
TAHLLQIWTVVDFCCEYLEQEVSEDNYLYLQELASIYSLKRLDAFIDSFVLSHFSTLSFT
PDFLQSISVQKLCVYLSSGQVQHKWEYDLLQVALQWLTQQPEREVHTRRVLENIRFPLFP
EDILLQRVKLAMCSLLPSEANGEGFVEEAMHYHNSLVAQPVLQTKRTLLRSEECLLFVGG
EVSERCLELSDDTCYLDTKNEQWVKETSLPARRSHHCVAVLGGFIFIAGGSFSRDNGGNA
ASNLLYRYDPRRKQWIKVASMNQRRVDFYLASIEDMLVAVGGRNENGALSSVETYSPKTN
SWTYVAGLPRFTYGHAGTIYKDFVYISGGHDYQIGPYRKNLLCYDHRTDVWEERRPMTTA
RGWHSMCSLGDSIYSIGGSDDHMESMERFDVLGVEAYSPQCNQWTRVAPLLQANSESGVA
VWQGRIYILGGYSWESTAFSRAVQVYDSEANRWSRGPDLPNAIAGVSACVCALNPRLEEK
KKRNKDKCQDRGQ
NT seq 1842 nt   +upstreamnt  +downstreamnt
atggaggcaagcaagcagatgcgggtatcccggccatacaaaatcagtgagtcttcaaag
gtgtaccactggcctgaccactctactgcggtgctgcagcggctgaacgagcagcggctg
cacggcctcttctgcgacgtggtgctggtggtcgaagagcagcaagtgccagcccaccgc
aaccttctggctgtgtgcagcgactacttcaactccatgttcacactgggcatgcgcgaa
gctttccagaaggaggtggagctggtgggcacctcctacgtggggctcaaggccgtggta
gatttcctctacagcagcgagctggagctggacggcagcaacattgactacatcctggag
acggcgcatctgctgcagatctggaccgtggtggatttctgctgtgagtacctggagcag
gaggtgagcgaggacaactatctctacctacaggagctggcctccatctacagtctcaag
aggctcgatgccttcatcgatagcttcgtactgagccacttcagcacgctgtccttcacg
cctgacttcctgcagtccatctccgtgcagaagctgtgtgtctacctgagcagtggccag
gtacagcacaaatgggaatacgacctgctgcaggtggctctgcagtggctcacgcagcag
ccggagcgcgaggtgcacacccgccgcgttctggagaacatccgcttccccctcttcccc
gaggacatcctgctacagcgggtgaagctggccatgtgctctctgctgcccagcgaggcc
aacggcgagggctttgtggaggaggccatgcactaccacaacagcctggtggcccagcct
gtcctgcagacgaagcgaacgctgctgcgctccgaggagtgcttgctcttcgtggggggc
gaggtctctgagcggtgtctggagctgagcgatgacacctgctacctagacaccaagaat
gagcagtgggtgaaggagacatccctgccggcccgccggagccaccactgcgtcgctgtg
ctggggggcttcatcttcattgccgggggcagcttctcgagagacaacggagggaatgcc
gcctccaaccttctttataggtatgacccccgccgtaaacagtggatcaaggtggcgtcc
atgaaccagcgccgtgtggatttctacctagcttccattgaagacatgctggtggctgtc
ggtggccggaacgagaatggagcgctgtcttctgtagagacctacagccccaagaccaac
tcctggacctacgtggccggcttgccaaggttcacctatggccacgcgggcaccatctac
aaagactttgtctacatctcagggggccacgactaccagattggcccgtaccgcaagaac
ctgctgtgttatgaccaccggacagacgtgtgggaggagaggcggcccatgacaacagct
cggggctggcacagcatgtgcagcctgggcgacagcatctactccatcgggggcagtgac
gaccacatggagtccatggagcgcttcgatgtgctgggcgtggaggcctacagcccacag
tgcaaccagtggactcgcgtggcgccgctgctgcaggccaacagcgagtcaggcgtggcc
gtgtggcagggccgcatctacatcctgggggggtacagctgggagagcacagccttctcc
agggctgtgcaggtgtatgatagcgaggccaacaggtggagccggggtcctgacctcccc
aacgccattgcgggtgtgtcggcctgtgtgtgtgccctcaacccaaggctggaggaaaag
aagaagaggaacaaggacaaatgccaggaccgaggtcagtga

DBGET integrated database retrieval system